Context Navigation

Back to Ticket #444

Ticket #444: fulltest.log

File fulltest.log, 245.2 KB (added by dukeleto, 4 years ago)

Line
1	make testb \
2	testC \
3	testf \
4	testg \
5	testj \
6	testr \
7	testS \
8	src_tests \
9	run_tests \
10	perl_tests \
11	codetest \
12	benchmark_tests \
13	manifest_tests \
14	examples_tests \
15	distro_tests
16	Compiling with:
17	xx.c
18	cc -I./include -g -pipe -fno-common -no-cpp-precomp -Wdeclaration-after-statement -I/usr/local/include -pipe -fno-common -Wno-long-double -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wbad-function-cast -Wdeclaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -g -Wno-shadow -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO -I. -o xx.o -c xx.c
19	make -C docs
20	perl -MExtUtils::Command -e mkpath ops
21	make -C src/dynpmc
22	perl -MExtUtils::Command -e cp *.bundle /Users/leto/svn/parrot/runtime/parrot/dynext
23	make -C src/dynoplibs
24	perl -MExtUtils::Command -e cp *.bundle /Users/leto/svn/parrot/runtime/parrot/dynext
25	make -C compilers/pct
26	make[2]: Nothing to be done for `all'.
27	make -C compilers/pge
28	make[2]: Nothing to be done for `all'.
29	make -C compilers/tge
30	make[2]: Nothing to be done for `all'.
31	make -C compilers/nqp
32	make[2]: Nothing to be done for `all'.
33	make -C compilers/json
34	make[2]: Nothing to be done for `all'.
35	perl t/harness --gc-debug --running-make-test -b --runcore-tests
36	t/compilers/imcc/imcpasm/cfg...........ok
37	t/compilers/imcc/imcpasm/opt0..........
38	ok 1 # SKIP disabled graph coloring register allocator, RT #57028
39	ok 3 # SKIP disabled graph coloring register allocator, RT #57028
40	ok
41	t/compilers/imcc/imcpasm/opt1..........
42	ok 76 # SKIP constant concat N/Y
43	ok
44	t/compilers/imcc/imcpasm/opt2..........
45	ok 5 # SKIP loop opt disabled for now
46	ok
47	t/compilers/imcc/imcpasm/optc..........
48	not ok 9 - tailcall 1 # TODO RT #57028
49	ok
50	t/compilers/imcc/imcpasm/pcc...........ok
51	t/compilers/imcc/imcpasm/sub...........ok
52	t/compilers/imcc/reg/alloc.............ok
53	t/compilers/imcc/reg/spill.............ok
54	t/compilers/imcc/syn/bsr...............ok
55	t/compilers/imcc/syn/clash.............
56	not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet
57	ok
58	t/compilers/imcc/syn/const.............ok
59	t/compilers/imcc/syn/errors............ok
60	t/compilers/imcc/syn/eval..............
61	ok 1 # SKIP changed eval semantics - see t/pmc/eval.t
62	ok 2 # SKIP changed eval semantics - see t/pmc/eval.t
63	ok 3 # SKIP changed eval semantics - see t/pmc/eval.t
64	ok 4 # SKIP changed eval semantics - see t/pmc/eval.t
65	ok 5 # SKIP changed eval semantics - see t/pmc/eval.t
66	ok 6 # SKIP changed eval semantics - see t/pmc/eval.t
67	ok 7 # SKIP changed eval semantics - see t/pmc/eval.t
68	ok
69	t/compilers/imcc/syn/file..............
70	ok 13 # SKIP multiple loading not speced - failing
71	ok
72	t/compilers/imcc/syn/hll...............ok
73	t/compilers/imcc/syn/keyed.............
74	ok 1 # SKIP experimental
75	ok
76	t/compilers/imcc/syn/labels............ok
77	t/compilers/imcc/syn/macro.............
78	not ok 25 - unterminated macro 2 # TODO Darwin segfault -- RT #60926
79	ok
80	t/compilers/imcc/syn/objects...........ok
81	t/compilers/imcc/syn/op................ok
82	t/compilers/imcc/syn/pasm..............ok
83	t/compilers/imcc/syn/pcc...............ok
84	t/compilers/imcc/syn/pod...............
85	ok 4 # SKIP Closing out of pod from included files
86	ok
87	t/compilers/imcc/syn/regressions.......
88	not ok 4 - comments between .param(RT \#46499) # TODO broken
89	not ok 6 - whitespace between .param(RT \#46499) # TODO broken
90	not ok 7 - off by one error message (RT \#40204) # TODO broken
91	ok
92	t/compilers/imcc/syn/scope.............ok
93	t/compilers/imcc/syn/subflags..........
94	not ok 15 # TODO :method sub not found in namespace
95	ok
96	t/compilers/imcc/syn/symbols...........ok
97	t/compilers/imcc/syn/tail..............ok
98	t/compilers/imcc/syn/veracity..........ok
99	t/op/00ff-dos..........................ok
100	t/op/00ff-unix.........................ok
101	t/op/01-parse_ops......................ok
102	t/op/64bit.............................
103	1..0 # Skip 64bit INTVAL platforms only
104	skipped: 64bit INTVAL platforms only
105	t/op/annotate..........................ok
106	t/op/arithmetics.......................
107	ok 28 # SKIP No integer overflow for 32-bit INTVALs without GMP installed
108	ok
109	t/op/basic.............................ok
110	t/op/bitwise...........................
111	ok 27 # SKIP no BigInt lib found
112	ok
113	t/op/box...............................ok
114	t/op/calling...........................
115	not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all
116	not ok 93 - arg mismatch with no params # TODO RT #39844
117	ok
118	t/op/cc_params.........................ok
119	t/op/cc_state..........................
120	not ok 6 - positional found, named expected # TODO cc processor state missing
121	not ok 8 - G2: argument underflow: required slurpy param # TODO failing
122	ok
123	t/op/cmp-nonbranch.....................ok
124	t/op/comp..............................ok
125	t/op/copy..............................ok
126	t/op/debuginfo.........................ok
127	t/op/exceptions........................
128	not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans
129	ok
130	t/op/gc................................ok
131	t/op/globals...........................ok
132	t/op/hacks.............................
133	ok 1 # SKIP no universal SIGFPE handling
134	ok 2 # SKIP no universal SIGFPE handling
135	ok
136	t/op/ifunless..........................ok
137	t/op/integer...........................ok
138	t/op/interp............................
139	ok 1 # SKIP we really shouldn't run just a label - use a sub
140	ok
141	t/op/io................................ok
142	t/op/jit...............................ok
143	t/op/jitn..............................ok
144	t/op/lexicals..........................
145	not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented
146	ok
147	t/op/literal...........................ok
148	t/op/load_bytecode.....................ok
149	t/op/number............................ok
150	t/op/pushaction........................
151	not ok 7 - pushaction: error while handling error # TODO runloop shenanigans
152	ok
153	t/op/say...............................ok
154	t/op/spawnw............................ok
155	t/op/sprintf...........................
156	ok 5 # SKIP parrot extension (%B)
157	ok 7 # SKIP perl5-specific extension (%D)
158	ok 9 # SKIP perl5-specific extension (%F)
159	ok 16 # SKIP parrot extension (%H)
160	ok 20 # SKIP parrot extension (%L)
161	ok 23 # SKIP perl5-specific extension (%O)
162	ok 24 # SKIP parrot extension (%P)
163	ok 27 # SKIP parrot extension (%S)
164	ok 29 # SKIP perl5-specific extension (%U)
165	not ok 64 # TODO [%03.2d] actual: > 01<
166	ok 71 # SKIP perl5-specific extension (%v...)
167	ok 72 # SKIP perl5-specific extension (%v...)
168	ok 73 # SKIP perl5-specific extension (%v...)
169	ok 74 # SKIP perl5-specific extension (%v...)
170	ok 75 # SKIP perl5-specific extension (%v...)
171	ok 76 # SKIP perl5-specific extension (%v...)
172	ok 77 # SKIP perl5-specific extension (%v...)
173	ok 78 # SKIP perl5-specific extension (%v...)
174	ok 79 # SKIP perl5-specific extension (%v...)
175	ok 80 # SKIP perl5-specific extension (%v...)
176	ok 81 # SKIP perl5-specific extension (%v...)
177	ok 82 # SKIP perl5-specific extension (%v...)
178	ok 83 # SKIP perl5-specific extension (%v...)
179	ok 84 # SKIP perl5-specific extension (%v...)
180	ok 85 # SKIP perl5-specific extension (%v...)
181	ok 86 # SKIP perl5-specific extension (%v...)
182	ok 87 # SKIP perl5-specific extension (%v...)
183	ok 88 # SKIP perl5-specific extension (%v...)
184	ok 89 # SKIP perl5-specific extension (%v...)
185	ok 90 # SKIP perl5-specific extension (%v...)
186	ok 91 # SKIP perl5-specific extension (%v...)
187	ok 92 # SKIP perl5-specific extension (%v...)
188	ok 93 # SKIP perl5-specific extension (%v...)
189	ok 94 # SKIP perl5-specific extension (%v...)
190	ok 95 # SKIP perl5-specific extension (%v...)
191	ok 96 # SKIP perl5-specific extension (%v...)
192	ok 97 # SKIP perl5-specific extension (%v...)
193	ok 98 # SKIP perl5-specific extension (%v...)
194	ok 99 # SKIP perl5-specific extension (%v...)
195	ok 114 # SKIP harness needs support for * modifier
196	ok 131 # SKIP harness needs support for * modifier
197	ok 141 # SKIP harness needs support for * modifier
198	ok 144 # SKIP perl5 expresssion as test value
199	not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1<
200	ok 161 # SKIP harness needs support for * modifier
201	ok 166 # SKIP harness needs support for * modifier
202	not ok 187 # TODO [%h] actual: ><
203	not ok 191 # TODO [%l] actual: ><
204	ok 193 # SKIP perl5-specific test
205	ok 200 # SKIP perl5-specific test
206	ok 201 # SKIP perl5-specific test
207	ok 202 # SKIP parrot extension (%p)
208	ok 204 # SKIP parrot extension (%r)
209	ok 210 # SKIP harness needs support for * modifier
210	ok 214 # SKIP harness needs support for * modifier
211	not ok 223 # TODO [%v] actual: ><
212	ok 233 # SKIP harness needs support for * modifier
213	ok 234 # SKIP perl5-specific extension (%v...)
214	ok 235 # SKIP perl5-specific extension (%v...)
215	ok 238 # SKIP perl5-specific test
216	ok 239 # SKIP perl5-specific test
217	ok 240 # SKIP perl5-specific test
218	ok 241 # SKIP perl5-specific test
219	ok 242 # SKIP perl5-specific test
220	ok 243 # SKIP perl5-specific test
221	ok 244 # SKIP perl5-specific test
222	ok 245 # SKIP perl5-specific test
223	ok 246 # SKIP perl5-specific test
224	ok 247 # SKIP perl5-specific test
225	ok 248 # SKIP perl5-specific test
226	ok 249 # SKIP perl5-specific test
227	ok 250 # SKIP perl5-specific test
228	ok 251 # SKIP perl5-specific test
229	ok 252 # SKIP perl5-specific extension (%v...)
230	ok 253 # SKIP perl5-specific extension (%v...)
231	ok 254 # SKIP perl5-specific extension (%v...)
232	ok 255 # SKIP perl5-specific extension (%v...)
233	ok 256 # SKIP perl5-specific extension (%v...)
234	ok 257 # SKIP perl5-specific extension (%v...)
235	ok 258 # SKIP perl5-specific extension (%v...)
236	ok 259 # SKIP perl5-specific extension (%v...)
237	ok 260 # SKIP perl5-specific extension (%v...)
238	ok 261 # SKIP perl5-specific extension (%v...)
239	ok 262 # SKIP perl5-specific extension (%v...)
240	ok 263 # SKIP perl5-specific extension (%v...)
241	ok 264 # SKIP perl5-specific extension (%v...)
242	ok 265 # SKIP perl5-specific extension (%v...)
243	ok 266 # SKIP perl5-specific extension (%v...)
244	ok 267 # SKIP perl5-specific extension (%v...)
245	ok 268 # SKIP perl5-specific extension (%v...)
246	ok 269 # SKIP perl5-specific extension (%v...)
247	ok 270 # SKIP perl5-specific extension (%v...)
248	ok 271 # SKIP perl5-specific extension (%v...)
249	ok 272 # SKIP perl5-specific extension (%v...)
250	ok 273 # SKIP perl5-specific extension (%v...)
251	ok 274 # SKIP perl5-specific extension (%v...)
252	ok 275 # SKIP perl5-specific extension (%v...)
253	ok 276 # SKIP perl5-specific extension (%v...)
254	ok 277 # SKIP perl5-specific extension (%v...)
255	ok 278 # SKIP perl5-specific extension (%v...)
256	ok 279 # SKIP perl5-specific extension (%v...)
257	ok 280 # SKIP perl5-specific extension (%v...)
258	ok 281 # SKIP perl5-specific extension (%v...)
259	ok 282 # SKIP perl5-specific extension (%v...)
260	ok 283 # SKIP perl5-specific extension (%v...)
261	ok 284 # SKIP perl5-specific extension (%v...)
262	ok 285 # SKIP perl5-specific extension (%v...)
263	ok 286 # SKIP perl5-specific extension (%v...)
264	ok 287 # SKIP perl5-specific extension (%v...)
265	ok 288 # SKIP perl5-specific extension (%v...)
266	ok 289 # SKIP perl5-specific extension (%v...)
267	ok 290 # SKIP perl5-specific extension (%v...)
268	ok 291 # SKIP perl5-specific extension (%v...)
269	ok 292 # SKIP perl5-specific extension (%v...)
270	ok 293 # SKIP perl5-specific extension (%v...)
271	ok 294 # SKIP perl5-specific extension (%v...)
272	ok 295 # SKIP perl5-specific extension (%v...)
273	ok 296 # SKIP perl5-specific extension (%v...)
274	ok 297 # SKIP perl5-specific extension (%v...)
275	ok 298 # SKIP perl5-specific extension (%v...)
276	ok 300 # SKIP harness needs support for * modifier
277	not ok 304 # TODO [%#b] actual: >0b0<
278	not ok 305 # TODO [%#o] actual: >00<
279	not ok 306 # TODO [%#x] actual: >0x0<
280	ok 307 # SKIP perl5-specific extension (%v...)
281	ok 308 # SKIP perl5-specific extension (%v...)
282	ok
283	t/op/sprintf2..........................ok
284	t/op/string............................
285	ok 103 # SKIP Pending rework of creating non-ascii literals
286	ok 104 # SKIP Pending rework of creating non-ascii literals
287	ok 118 # SKIP Pending reimplementation of find_encoding
288	ok 119 # SKIP no more visible encoding
289	ok 137 # SKIP No unicode yet
290	ok 139 # SKIP no more transcode
291	ok 140 # SKIP no more chartype
292	ok
293	t/op/string_cclass.....................
294	ok 7 # SKIP unicode support unavailable
295	ok 8 # SKIP unicode support unavailable
296	ok 9 # SKIP unicode support unavailable
297	ok
298	t/op/string_cs.........................
299	ok 31 # SKIP no ICU lib
300	ok 32 # SKIP no ICU lib
301	ok 33 # SKIP no ICU lib
302	ok 34 # SKIP no ICU lib
303	ok 35 # SKIP no ICU lib
304	ok 36 # SKIP no ICU lib
305	ok 37 # SKIP no ICU lib
306	ok 38 # SKIP no ICU lib
307	ok 39 # SKIP no ICU lib
308	ok 40 # SKIP no ICU lib
309	ok 41 # SKIP no ICU lib
310	ok 42 # SKIP no ICU lib
311	ok 43 # SKIP no ICU lib
312	ok 44 # SKIP no ICU lib
313	ok 45 # SKIP no ICU lib
314	ok 46 # SKIP no ICU lib
315	ok
316	t/op/string_mem........................ok
317	t/op/stringu...........................
318	ok 20 # SKIP no ICU lib
319	ok 21 # SKIP no ICU lib
320	ok 22 # SKIP no ICU lib
321	ok 25 # SKIP Tests seem to fail on big endian machines with icu
322	ok 26 # SKIP Tests seem to fail on big endian machines with icu
323	not ok 27 - UTF-8 and Unicode literals # TODO TT #24
324	ok
325	t/op/sysinfo...........................
326	not ok 11 - sysinfo OS version string # TODO Not Currently Implemented
327	not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented
328	ok 13 # SKIP Requires a lot of work to find out the correct answer
329	ok 14 # SKIP Testing only in some known platforms
330	ok
331	t/op/time..............................ok
332	t/op/trans.............................ok
333	t/pmc/addrregistry.....................ok
334	t/pmc/array............................
335	not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken
336	ok
337	t/pmc/bigint...........................
338	1..0 # Skip No BigInt Lib configured
339	skipped: No BigInt Lib configured
340	t/pmc/bignum...........................
341	1..0 # Skip No BigNum PMC enabled
342	skipped: No BigNum PMC enabled
343	t/pmc/boolean..........................ok
344	t/pmc/bound_nci........................ok
345	t/pmc/callsignature....................ok
346	t/pmc/capture..........................ok
347	t/pmc/class............................
348	not ok 28 # TODO add_method() invoking method added to class works
349	ok
350	t/pmc/codestring.......................ok
351	t/pmc/complex..........................
352	ok 58 # SKIP div by zero not caught
353	ok 59 # SKIP div by zero not caught
354	ok 60 # SKIP div by zero not caught
355	ok 86 # SKIP instantiate n/y
356	ok 87 # SKIP instantiate n/y
357	ok 88 # SKIP instantiate n/y
358	ok 89 # SKIP instantiate n/y
359	ok 126 # SKIP inf is not platform-independent
360	ok 465 # SKIP add using subclass of Complex - RT #59630
361	ok 466 # SKIP add using subclass of Complex - RT #59630
362	ok 467 # SKIP add using subclass of Complex - RT #59630
363	ok
364	t/pmc/config...........................ok
365	t/pmc/continuation.....................ok
366	t/pmc/coroutine........................
367	not ok 9 - Call an exited coroutine # TODO goes one iteration too far.
368	ok
369	t/pmc/cpointer.........................ok
370	t/pmc/default..........................
371	not ok 1 - new # TODO not implemeted
372	ok
373	t/pmc/env..............................ok
374	t/pmc/eval.............................ok
375	t/pmc/eventhandler.....................ok
376	t/pmc/exception........................
377	not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans
378	not ok 25 - pushaction: error while handling error # TODO runloop shenanigans
379	not ok 27 - invoke handler in calling sub # TODO deprecate rethrow
380	not ok 30 - catch ex from C-level MULTI function # TODO broken
381	ok
382	t/pmc/exceptionhandler.................ok
383	t/pmc/exporter.........................ok
384	t/pmc/file.............................ok
385	t/pmc/filehandle.......................
386	ok 3 # SKIP no asynch calls yet
387	not ok 8 - record_separator # TODO not yet implemented
388	ok
389	t/pmc/fixedbooleanarray................ok
390	t/pmc/fixedfloatarray..................ok
391	t/pmc/fixedintegerarray................ok
392	t/pmc/fixedpmcarray....................ok
393	t/pmc/fixedstringarray.................ok
394	t/pmc/float............................ok
395	t/pmc/freeze...........................ok
396	t/pmc/globals..........................ok
397	t/pmc/hash.............................ok
398	t/pmc/integer..........................ok
399	t/pmc/io...............................
400	not ok 1 - IO on some invalid types # TODO IO on some invalid types
401	ok 8 # SKIP clone not finished yet
402	not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433
403	not ok 40 - string read/write handle # TODO no stringhandle yet
404	ok
405	t/pmc/io_iterator......................
406	not ok 1 - new # TODO not yet implemented
407	not ok 2 - shift # TODO not yet implemented
408	not ok 3 - get_bool (vtable) # TODO not yet implemented
409	ok
410	t/pmc/io_status........................
411	not ok 1 - new # TODO not yet implemented
412	not ok 2 - get_integer (vtable) # TODO not yet implemented
413	not ok 3 - get_bool (vtable) # TODO not yet implemented
414	not ok 4 - return # TODO not yet implemented
415	not ok 5 - error # TODO not yet implemented
416	not ok 6 - throw # TODO not yet implemented
417	ok
418	t/pmc/iterator.........................
419	ok 13 # SKIP N/Y: length of rest of array
420	not ok 16 - adding keys during iteration # TODO adding keys during iteration
421	not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points'
422	ok
423	t/pmc/key..............................
424	not ok 10 # TODO register and non-register string keys should be COW (RT #60128)
425	ok
426	t/pmc/lexinfo..........................ok
427	t/pmc/lexpad...........................ok
428	t/pmc/managedstruct....................ok
429	t/pmc/multidispatch....................
430	not ok 22 - MMD on PMC types - Any # TODO RT #41374
431	not ok 25 - add as method - inherited # TODO RT #41374
432	not ok 32 - use a core func for an object # TODO RT #59628
433	ok
434	t/pmc/multisub.........................ok
435	t/pmc/namespace........................
436	not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17
437	ok
438	t/pmc/nci..............................ok
439	t/pmc/null.............................ok
440	t/pmc/object-meths.....................
441	ok 14 # SKIP currently broken
442	ok 25 # SKIP no bound NCI method
443	ok
444	t/pmc/object-mro.......................ok
445	t/pmc/object...........................ok
446	t/pmc/objects..........................ok
447	t/pmc/orderedhash......................ok
448	t/pmc/os...............................ok
449	t/pmc/packfile.........................ok
450	t/pmc/packfileconstanttable............
451	not ok 3 - get_type, get_*_keyed_int # TODO See TT #385.
452	ok
453	t/pmc/packfiledirectory................ok
454	t/pmc/packfilefixupentry...............ok
455	t/pmc/packfilefixuptable...............ok
456	t/pmc/packfilerawsegment...............ok
457	t/pmc/packfilesegment..................ok
458	t/pmc/parrotclass......................ok
459	t/pmc/parrotinterpreter................ok
460	t/pmc/parrotio.........................
461	not ok 2 - open and close - synchronous # TODO not yet implemented
462	ok 3 # SKIP no asynch calls yet
463	not ok 4 - print, read, and readline - synchronous # TODO not yet implemented
464	not ok 5 - record_separator # TODO not yet implemented
465	not ok 6 - buffer_type # TODO not yet implemented
466	ok
467	t/pmc/parrotlibrary....................ok
468	t/pmc/parrotobject.....................ok
469	t/pmc/parrotrunningthread..............ok
470	t/pmc/parrotthread.....................ok
471	t/pmc/pccmethod_test...................ok
472	t/pmc/pmc..............................ok
473	t/pmc/pmcproxy.........................ok
474	t/pmc/pointer..........................ok
475	t/pmc/prop.............................ok
476	t/pmc/random...........................ok
477	t/pmc/ref..............................ok
478	t/pmc/resizablebooleanarray............ok
479	t/pmc/resizablefloatarray..............ok
480	t/pmc/resizableintegerarray............ok
481	t/pmc/resizablepmcarray................ok
482	t/pmc/resizablestringarray.............ok
483	t/pmc/retcontinuation..................ok
484	t/pmc/ro...............................
485	not ok 8 - ResizablePMCArray -- Recursive # TODO 1
486	ok
487	t/pmc/role.............................ok
488	t/pmc/scalar...........................
489	ok 1 # SKIP doesn't work yet
490	ok
491	t/pmc/scheduler........................ok
492	t/pmc/schedulermessage.................ok
493	t/pmc/sharedref........................ok
494	t/pmc/signal...........................
495	1..0 # Skip Signals currently disabled
496	skipped: Signals currently disabled
497	t/pmc/slice............................
498	not ok 2 - bug with slice bits # TODO parser
499	ok
500	t/pmc/string...........................ok
501	t/pmc/stringhandle.....................
502	ok 3 # SKIP no asynch calls yet
503	not ok 9 - record_separator # TODO not yet implemented
504	ok
505	t/pmc/sub..............................ok
506	t/pmc/sys..............................ok
507	t/pmc/task.............................ok
508	t/pmc/threads..........................
509	not ok 11 - CLONE_CODE \| CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511
510	not ok 15 - CLONE_CODE\|CLONE_GLOBALS\|CLONE_HLL\|CLONE_LIBRARIES # TODO RT #41373
511	ok
512	t/pmc/timer............................ok
513	t/pmc/undef............................ok
514	t/pmc/unmanagedstruct..................ok
515	t/oo/attributes........................ok
516	t/oo/composition.......................ok
517	t/oo/inheritance.......................ok
518	t/oo/isa...............................ok
519	t/oo/metamodel.........................
520	not ok 6 # TODO tail attribute has a type
521	not ok 12 # TODO new opcode makes working objects
522	ok
523	t/oo/methods...........................ok
524	t/oo/mro-c3............................ok
525	t/oo/names.............................ok
526	t/oo/new...............................ok
527	t/oo/ops...............................ok
528	t/oo/proxy.............................ok
529	t/oo/subclass..........................ok
530	t/oo/vtableoverride....................ok
531	t/native_pbc/header....................
532	1..0 # Skip pending robust testing strategy, TT #357
533	skipped: pending robust testing strategy, TT #357
534	t/native_pbc/integer...................
535	1..0 # Skip pending robust testing strategy, TT #357
536	skipped: pending robust testing strategy, TT #357
537	t/native_pbc/number....................
538	1..0 # Skip pending robust testing strategy, TT #357
539	skipped: pending robust testing strategy, TT #357
540	t/native_pbc/string....................
541	1..0 # Skip pending robust testing strategy, TT #357
542	skipped: pending robust testing strategy, TT #357
543	t/dynpmc/dynlexpad.....................
544	not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads
545	ok
546	t/dynpmc/foo...........................
547	ok 6 # SKIP No BigInt Lib configured
548	ok
549	t/dynpmc/gdbmhash......................
550	1..0 # Skip No gdbm library available
551	skipped: No gdbm library available
552	t/dynpmc/md2...........................ok
553	t/dynpmc/md4...........................ok
554	t/dynpmc/md5...........................ok
555	t/dynpmc/pair..........................ok
556	t/dynpmc/rational......................ok
557	t/dynpmc/ripemd160.....................ok
558	t/dynpmc/rotest........................ok
559	t/dynpmc/sha...........................ok
560	t/dynpmc/sha1..........................ok
561	t/dynpmc/sha256........................
562	1..0 # Skip Too old library
563	skipped: Too old library
564	t/dynpmc/sha512........................
565	1..0 # Skip Too old library
566	skipped: Too old library
567	t/dynpmc/subclass_with_pir_method......
568	not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces
569	not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces
570	ok
571	t/dynpmc/subproxy......................ok
572	t/dynoplibs/dan........................ok
573	t/dynoplibs/myops......................ok
574	t/compilers/pct/complete_workflow......ok
575	t/compilers/pct/past...................ok
576	t/compilers/pct/pct_hllcompiler........ok
577	t/compilers/pct/post...................ok
578	t/compilers/pge/00-basic...............ok
579	t/compilers/pge/02-match...............ok
580	t/compilers/pge/03-optable.............ok
581	t/compilers/pge/04-compile.............ok
582	t/compilers/pge/06-grammar.............ok
583	t/compilers/pge/pge-hs.................ok
584	t/compilers/pge/pge....................ok
585	t/compilers/pge/pge_examples...........ok
586	t/compilers/pge/pge_globs..............ok
587	t/compilers/pge/pge_text...............ok
588	t/compilers/pge/pge_util...............ok
589	t/compilers/pge/p5regex/p5rx...........
590	not ok 116 # TODO [re_tests:116] character class in enumeration
591	not ok 119 # TODO [re_tests:119] character class in enumeration
592	not ok 120 # TODO [re_tests:120] character class in enumeration
593	not ok 123 # TODO [re_tests:123] character class in enumeration
594	not ok 124 # TODO [re_tests:124] character class in enumeration
595	not ok 127 # TODO [re_tests:127] character class in enumeration
596	ok 138 # SKIP [re_tests:138] parser bug
597	ok 139 # SKIP [re_tests:139] broken col 4?
598	ok 143 # SKIP [re_tests:143] bug or error
599	ok 144 # SKIP [re_tests:144] bug or error
600	ok 148 # SKIP [re_tests:148] bug or error
601	ok 149 # SKIP [re_tests:149] bug or error
602	ok 155 # SKIP [re_tests:155] bug or error
603	ok 167 # SKIP [re_tests:167] bug or error
604	not ok 234 # TODO [re_tests:234] unknown reason
605	not ok 235 # TODO [re_tests:235] unknown reason
606	not ok 236 # TODO [re_tests:236] unknown reason
607	not ok 246 # TODO [re_tests:246] unknown reason
608	not ok 247 # TODO [re_tests:247] unknown reason
609	ok 248 # SKIP [re_tests:248] bug or error
610	ok 249 # SKIP [re_tests:249] bug or error
611	ok 252 # SKIP [re_tests:252] bug or error
612	not ok 254 # TODO [re_tests:254] unknown reason
613	not ok 256 # TODO [re_tests:256] unknown reason
614	not ok 257 # TODO [re_tests:257] unknown reason
615	ok 264 # SKIP [re_tests:264] trailing modifiers
616	ok 265 # SKIP [re_tests:265] trailing modifiers
617	ok 266 # SKIP [re_tests:266] trailing modifiers
618	ok 267 # SKIP [re_tests:267] trailing modifiers
619	ok 268 # SKIP [re_tests:268] trailing modifiers
620	ok 269 # SKIP [re_tests:269] trailing modifiers
621	ok 270 # SKIP [re_tests:270] trailing modifiers
622	ok 271 # SKIP [re_tests:271] trailing modifiers
623	ok 272 # SKIP [re_tests:272] trailing modifiers
624	ok 273 # SKIP [re_tests:273] trailing modifiers
625	ok 274 # SKIP [re_tests:274] trailing modifiers
626	ok 275 # SKIP [re_tests:275] trailing modifiers
627	ok 276 # SKIP [re_tests:276] trailing modifiers
628	ok 277 # SKIP [re_tests:277] trailing modifiers
629	ok 278 # SKIP [re_tests:278] trailing modifiers
630	ok 279 # SKIP [re_tests:279] trailing modifiers
631	ok 280 # SKIP [re_tests:280] trailing modifiers
632	ok 281 # SKIP [re_tests:281] trailing modifiers
633	ok 282 # SKIP [re_tests:282] trailing modifiers
634	ok 283 # SKIP [re_tests:283] trailing modifiers
635	ok 284 # SKIP [re_tests:284] trailing modifiers
636	ok 285 # SKIP [re_tests:285] trailing modifiers
637	ok 286 # SKIP [re_tests:286] trailing modifiers
638	ok 287 # SKIP [re_tests:287] trailing modifiers
639	ok 288 # SKIP [re_tests:288] trailing modifiers
640	ok 289 # SKIP [re_tests:289] trailing modifiers
641	ok 290 # SKIP [re_tests:290] trailing modifiers
642	ok 291 # SKIP [re_tests:291] trailing modifiers
643	ok 292 # SKIP [re_tests:292] trailing modifiers
644	ok 293 # SKIP [re_tests:293] trailing modifiers
645	ok 294 # SKIP [re_tests:294] trailing modifiers
646	ok 295 # SKIP [re_tests:295] trailing modifiers
647	ok 296 # SKIP [re_tests:296] trailing modifiers
648	ok 297 # SKIP [re_tests:297] trailing modifiers
649	ok 298 # SKIP [re_tests:298] trailing modifiers
650	ok 299 # SKIP [re_tests:299] trailing modifiers
651	ok 300 # SKIP [re_tests:300] trailing modifiers
652	ok 301 # SKIP [re_tests:301] trailing modifiers
653	ok 302 # SKIP [re_tests:302] trailing modifiers
654	ok 303 # SKIP [re_tests:303] trailing modifiers
655	ok 304 # SKIP [re_tests:304] trailing modifiers
656	ok 305 # SKIP [re_tests:305] trailing modifiers
657	ok 306 # SKIP [re_tests:306] trailing modifiers
658	ok 307 # SKIP [re_tests:307] trailing modifiers
659	ok 308 # SKIP [re_tests:308] bug or error
660	ok 309 # SKIP [re_tests:309] bug or error
661	ok 310 # SKIP [re_tests:310] bug or error
662	ok 311 # SKIP [re_tests:311] trailing modifiers
663	ok 312 # SKIP [re_tests:312] trailing modifiers
664	ok 313 # SKIP [re_tests:313] trailing modifiers
665	ok 314 # SKIP [re_tests:314] trailing modifiers
666	ok 315 # SKIP [re_tests:315] trailing modifiers
667	ok 316 # SKIP [re_tests:316] trailing modifiers
668	ok 317 # SKIP [re_tests:317] trailing modifiers
669	ok 318 # SKIP [re_tests:318] trailing modifiers
670	ok 319 # SKIP [re_tests:319] trailing modifiers
671	ok 320 # SKIP [re_tests:320] trailing modifiers
672	ok 321 # SKIP [re_tests:321] trailing modifiers
673	ok 322 # SKIP [re_tests:322] bug or error
674	ok 323 # SKIP [re_tests:323] bug or error
675	ok 324 # SKIP [re_tests:324] trailing modifiers
676	ok 325 # SKIP [re_tests:325] bug or error
677	ok 326 # SKIP [re_tests:326] trailing modifiers
678	ok 327 # SKIP [re_tests:327] trailing modifiers
679	ok 328 # SKIP [re_tests:328] trailing modifiers
680	ok 329 # SKIP [re_tests:329] trailing modifiers
681	ok 330 # SKIP [re_tests:330] bug or error
682	ok 331 # SKIP [re_tests:331] bug or error
683	ok 332 # SKIP [re_tests:332] trailing modifiers
684	ok 333 # SKIP [re_tests:333] trailing modifiers
685	ok 334 # SKIP [re_tests:334] trailing modifiers
686	ok 335 # SKIP [re_tests:335] trailing modifiers
687	ok 336 # SKIP [re_tests:336] bug or error
688	ok 337 # SKIP [re_tests:337] trailing modifiers
689	ok 338 # SKIP [re_tests:338] trailing modifiers
690	ok 339 # SKIP [re_tests:339] trailing modifiers
691	ok 340 # SKIP [re_tests:340] trailing modifiers
692	ok 341 # SKIP [re_tests:341] trailing modifiers
693	ok 342 # SKIP [re_tests:342] trailing modifiers
694	ok 343 # SKIP [re_tests:343] trailing modifiers
695	ok 344 # SKIP [re_tests:344] trailing modifiers
696	ok 345 # SKIP [re_tests:345] trailing modifiers
697	ok 346 # SKIP [re_tests:346] trailing modifiers
698	ok 347 # SKIP [re_tests:347] bug or error
699	ok 348 # SKIP [re_tests:348] trailing modifiers
700	ok 349 # SKIP [re_tests:349] trailing modifiers
701	ok 350 # SKIP [re_tests:350] trailing modifiers
702	ok 351 # SKIP [re_tests:351] trailing modifiers
703	ok 352 # SKIP [re_tests:352] trailing modifiers
704	ok 353 # SKIP [re_tests:353] trailing modifiers
705	ok 354 # SKIP [re_tests:354] trailing modifiers
706	ok 355 # SKIP [re_tests:355] trailing modifiers
707	ok 356 # SKIP [re_tests:356] trailing modifiers
708	ok 357 # SKIP [re_tests:357] trailing modifiers
709	ok 358 # SKIP [re_tests:358] trailing modifiers
710	ok 359 # SKIP [re_tests:359] trailing modifiers
711	ok 360 # SKIP [re_tests:360] trailing modifiers
712	ok 361 # SKIP [re_tests:361] trailing modifiers
713	ok 362 # SKIP [re_tests:362] trailing modifiers
714	ok 363 # SKIP [re_tests:363] trailing modifiers
715	ok 364 # SKIP [re_tests:364] trailing modifiers
716	ok 365 # SKIP [re_tests:365] trailing modifiers
717	ok 366 # SKIP [re_tests:366] trailing modifiers
718	ok 367 # SKIP [re_tests:367] trailing modifiers
719	ok 368 # SKIP [re_tests:368] trailing modifiers
720	ok 369 # SKIP [re_tests:369] trailing modifiers
721	ok 370 # SKIP [re_tests:370] trailing modifiers
722	ok 371 # SKIP [re_tests:371] trailing modifiers
723	ok 372 # SKIP [re_tests:372] trailing modifiers
724	ok 373 # SKIP [re_tests:373] trailing modifiers
725	ok 374 # SKIP [re_tests:374] trailing modifiers
726	ok 375 # SKIP [re_tests:375] trailing modifiers
727	ok 376 # SKIP [re_tests:376] trailing modifiers
728	ok 377 # SKIP [re_tests:377] trailing modifiers
729	ok 378 # SKIP [re_tests:378] trailing modifiers
730	ok 379 # SKIP [re_tests:379] trailing modifiers
731	ok 380 # SKIP [re_tests:380] trailing modifiers
732	ok 381 # SKIP [re_tests:381] trailing modifiers
733	ok 382 # SKIP [re_tests:382] trailing modifiers
734	ok 383 # SKIP [re_tests:383] trailing modifiers
735	ok 384 # SKIP [re_tests:384] trailing modifiers
736	ok 385 # SKIP [re_tests:385] trailing modifiers
737	ok 386 # SKIP [re_tests:386] trailing modifiers
738	ok 387 # SKIP [re_tests:387] trailing modifiers
739	ok 388 # SKIP [re_tests:388] trailing modifiers
740	ok 389 # SKIP [re_tests:389] trailing modifiers
741	ok 390 # SKIP [re_tests:390] trailing modifiers
742	ok 391 # SKIP [re_tests:391] trailing modifiers
743	ok 392 # SKIP [re_tests:392] trailing modifiers
744	ok 393 # SKIP [re_tests:393] trailing modifiers
745	ok 394 # SKIP [re_tests:394] trailing modifiers
746	ok 395 # SKIP [re_tests:395] trailing modifiers
747	not ok 396 # TODO [re_tests:396] unknown reason
748	not ok 397 # TODO [re_tests:397] unknown reason
749	not ok 398 # TODO [re_tests:398] unknown reason
750	ok 408 # SKIP [re_tests:408] bug or error
751	not ok 419 # TODO [re_tests:419] unknown reason
752	not ok 422 # TODO [re_tests:422] unknown reason
753	not ok 429 # TODO [re_tests:429] unknown reason
754	not ok 432 # TODO [re_tests:432] unknown reason
755	not ok 434 # TODO [re_tests:434] unknown reason
756	not ok 435 # TODO [re_tests:435] unknown reason
757	ok 436 # SKIP [re_tests:436] bug or error
758	not ok 439 # TODO [re_tests:439] unknown reason
759	not ok 446 # TODO [re_tests:446] unknown reason
760	not ok 447 # TODO [re_tests:447] unknown reason
761	not ok 448 # TODO [re_tests:448] unknown reason
762	not ok 449 # TODO [re_tests:449] unknown reason
763	not ok 452 # TODO [re_tests:452] unknown reason
764	not ok 453 # TODO [re_tests:453] unknown reason
765	not ok 454 # TODO [re_tests:454] unknown reason
766	not ok 455 # TODO [re_tests:455] unknown reason
767	ok 458 # SKIP [re_tests:458] unknown reason
768	ok 459 # SKIP [re_tests:459] unknown reason
769	ok 460 # SKIP [re_tests:460] unknown reason
770	ok 461 # SKIP [re_tests:461] unknown reason
771	ok 462 # SKIP [re_tests:462] unknown reason
772	ok 463 # SKIP [re_tests:463] unknown reason
773	ok 464 # SKIP [re_tests:464] unknown reason
774	ok 465 # SKIP [re_tests:465] unknown reason
775	ok 466 # SKIP [re_tests:466] unknown reason
776	ok 467 # SKIP [re_tests:467] unknown reason
777	ok 468 # SKIP [re_tests:468] unknown reason
778	ok 469 # SKIP [re_tests:469] unknown reason
779	ok 470 # SKIP [re_tests:470] unknown reason
780	ok 471 # SKIP [re_tests:471] unknown reason
781	ok 472 # SKIP [re_tests:472] unknown reason
782	ok 473 # SKIP [re_tests:473] unknown reason
783	ok 474 # SKIP [re_tests:474] unknown reason
784	ok 475 # SKIP [re_tests:475] unknown reason
785	ok 476 # SKIP [re_tests:476] unknown reason
786	ok 477 # SKIP [re_tests:477] unknown reason
787	ok 478 # SKIP [re_tests:478] unknown reason
788	ok 479 # SKIP [re_tests:479] unknown reason
789	ok 480 # SKIP [re_tests:480] unknown reason
790	ok 483 # SKIP [re_tests:483]
791	ok 484 # SKIP [re_tests:484]
792	ok 487 # SKIP [re_tests:487] bug or error
793	ok 488 # SKIP [re_tests:488] bug or error
794	ok 489 # SKIP [re_tests:489] bug or error
795	ok 490 # SKIP [re_tests:490] bug or error
796	ok 491 # SKIP [re_tests:491] kills a parrot
797	ok 492 # SKIP [re_tests:492] bug or error
798	ok 493 # SKIP [re_tests:493] kills a parrot
799	not ok 495 # TODO [re_tests:495] unknown reason
800	ok 496 # SKIP [re_tests:496]
801	not ok 498 # TODO [re_tests:498] unknown reason
802	not ok 500 # TODO [re_tests:500] unknown reason
803	not ok 501 # TODO [re_tests:501] unknown reason
804	ok 502 # SKIP [re_tests:502] unknown reason
805	not ok 503 # TODO [re_tests:503] unknown reason
806	not ok 504 # TODO [re_tests:504] unknown reason
807	not ok 505 # TODO [re_tests:505] unknown reason
808	not ok 506 # TODO [re_tests:506] unknown reason
809	not ok 507 # TODO [re_tests:507] unknown reason
810	not ok 508 # TODO [re_tests:508] unknown reason
811	not ok 509 # TODO [re_tests:509] unknown reason
812	not ok 510 # TODO [re_tests:510] unknown reason
813	not ok 511 # TODO [re_tests:511] unknown reason
814	not ok 512 # TODO [re_tests:512] unknown reason
815	not ok 515 # TODO [re_tests:515] unknown reason
816	not ok 521 # TODO [re_tests:521] unknown reason
817	not ok 522 # TODO [re_tests:522] unknown reason
818	not ok 523 # TODO [re_tests:523] unknown reason
819	not ok 524 # TODO [re_tests:524] unknown reason
820	not ok 527 # TODO [re_tests:527] unknown reason
821	not ok 528 # TODO [re_tests:528] unknown reason
822	ok 531 # SKIP [re_tests:531] bug or error
823	ok 532 # SKIP [re_tests:532] bug or error
824	not ok 535 # TODO [re_tests:535] unknown reason
825	not ok 536 # TODO [re_tests:536] unknown reason
826	not ok 539 # TODO [re_tests:539] unknown reason
827	not ok 540 # TODO [re_tests:540] unknown reason
828	not ok 541 # TODO [re_tests:541] unknown reason
829	not ok 544 # TODO [re_tests:544] unknown reason
830	not ok 545 # TODO [re_tests:545] unknown reason
831	ok 556 # SKIP [re_tests:556] kills a parrot
832	ok 557 # SKIP [re_tests:557] kills a parrot
833	not ok 559 # TODO [re_tests:559] unknown reason
834	ok 563 # SKIP [re_tests:563] bug or error
835	ok 564 # SKIP [re_tests:564] bug or error
836	ok 566 # SKIP [re_tests:566] bug or error
837	ok 568 # SKIP [re_tests:568] kills a parrot
838	ok 569 # SKIP [re_tests:569] kills a parrot
839	ok 570 # SKIP [re_tests:570] kills a parrot
840	ok 571 # SKIP [re_tests:571] kills a parrot
841	ok 572 # SKIP [re_tests:572] kills a parrot
842	ok 573 # SKIP [re_tests:573] kills a parrot
843	ok 574 # SKIP [re_tests:574] kills a parrot
844	ok 575 # SKIP [re_tests:575] kills a parrot
845	ok 576 # SKIP [re_tests:576] kills a parrot
846	ok 577 # SKIP [re_tests:577] kills a parrot
847	ok 578 # SKIP [re_tests:578] kills a parrot
848	ok 579 # SKIP [re_tests:579] kills a parrot
849	ok 580 # SKIP [re_tests:580] kills a parrot
850	ok 581 # SKIP [re_tests:581] kills a parrot
851	ok 582 # SKIP [re_tests:582] kills a parrot
852	ok 583 # SKIP [re_tests:583] kills a parrot
853	ok 584 # SKIP [re_tests:584] kills a parrot
854	ok 585 # SKIP [re_tests:585] kills a parrot
855	ok 586 # SKIP [re_tests:586] kills a parrot
856	ok 587 # SKIP [re_tests:587] kills a parrot
857	ok 588 # SKIP [re_tests:588] kills a parrot
858	ok 589 # SKIP [re_tests:589] kills a parrot
859	ok 590 # SKIP [re_tests:590] kills a parrot
860	ok 591 # SKIP [re_tests:591] kills a parrot
861	ok 592 # SKIP [re_tests:592] kills a parrot
862	ok 593 # SKIP [re_tests:593] bug or error
863	ok 594 # SKIP [re_tests:594] bug or error
864	not ok 595 # TODO [re_tests:595] unknown reason
865	not ok 596 # TODO [re_tests:596] unknown reason
866	ok 597 # SKIP [re_tests:597] unknown reason
867	ok 598 # SKIP [re_tests:598] bug or error
868	ok 599 # SKIP [re_tests:599] bug or error
869	not ok 600 # TODO [re_tests:600] unknown reason
870	not ok 601 # TODO [re_tests:601] unknown reason
871	not ok 603 # TODO [re_tests:603] unknown reason
872	not ok 604 # TODO [re_tests:604] unknown reason
873	not ok 606 # TODO [re_tests:606] unknown reason
874	not ok 607 # TODO [re_tests:607] unknown reason
875	ok 609 # SKIP [re_tests:609] unknown reason
876	ok 610 # SKIP [re_tests:610] unknown reason
877	ok 611 # SKIP [re_tests:611] unknown reason
878	ok 612 # SKIP [re_tests:612] unknown reason
879	ok 613 # SKIP [re_tests:613] unknown reason
880	ok 614 # SKIP [re_tests:614] unknown reason
881	ok 615 # SKIP [re_tests:615] unknown reason
882	ok 616 # SKIP [re_tests:616] unknown reason
883	ok 617 # SKIP [re_tests:617] unknown reason
884	not ok 621 # TODO [re_tests:621] unknown reason
885	not ok 623 # TODO [re_tests:623] unknown reason
886	not ok 624 # TODO [re_tests:624] unknown reason
887	not ok 625 # TODO [re_tests:625] unknown reason
888	ok 627 # SKIP [re_tests:627] unknown reason
889	ok 628 # SKIP [re_tests:628] unknown reason
890	ok 629 # SKIP [re_tests:629] unknown reason
891	ok 630 # SKIP [re_tests:630] unknown reason
892	ok 631 # SKIP [re_tests:631] unknown reason
893	ok 632 # SKIP [re_tests:632] unknown reason
894	ok 633 # SKIP [re_tests:633] unknown reason
895	ok 634 # SKIP [re_tests:634] unknown reason
896	ok 635 # SKIP [re_tests:635] unknown reason
897	not ok 639 # TODO [re_tests:639] unknown reason
898	not ok 641 # TODO [re_tests:641] unknown reason
899	not ok 642 # TODO [re_tests:642] unknown reason
900	not ok 643 # TODO [re_tests:643] unknown reason
901	ok 645 # SKIP [re_tests:645] unknown reason
902	ok 646 # SKIP [re_tests:646] unknown reason
903	ok 647 # SKIP [re_tests:647] unknown reason
904	ok 648 # SKIP [re_tests:648] unknown reason
905	ok 649 # SKIP [re_tests:649] unknown reason
906	ok 650 # SKIP [re_tests:650] unknown reason
907	ok 651 # SKIP [re_tests:651] unknown reason
908	ok 652 # SKIP [re_tests:652] unknown reason
909	ok 653 # SKIP [re_tests:653] unknown reason
910	ok 663 # SKIP [re_tests:663] unknown reason
911	ok 664 # SKIP [re_tests:664] unknown reason
912	ok 665 # SKIP [re_tests:665] unknown reason
913	ok 666 # SKIP [re_tests:666] unknown reason
914	ok 667 # SKIP [re_tests:667] unknown reason
915	ok 668 # SKIP [re_tests:668] unknown reason
916	ok 669 # SKIP [re_tests:669] unknown reason
917	ok 670 # SKIP [re_tests:670] unknown reason
918	ok 671 # SKIP [re_tests:671] unknown reason
919	ok 681 # SKIP [re_tests:681] unknown reason
920	ok 682 # SKIP [re_tests:682] unknown reason
921	ok 683 # SKIP [re_tests:683] unknown reason
922	ok 684 # SKIP [re_tests:684] unknown reason
923	ok 685 # SKIP [re_tests:685] unknown reason
924	ok 686 # SKIP [re_tests:686] unknown reason
925	ok 687 # SKIP [re_tests:687] unknown reason
926	ok 688 # SKIP [re_tests:688] unknown reason
927	ok 689 # SKIP [re_tests:689] unknown reason
928	not ok 693 # TODO [re_tests:693] unknown reason
929	not ok 695 # TODO [re_tests:695] unknown reason
930	not ok 696 # TODO [re_tests:696] unknown reason
931	not ok 697 # TODO [re_tests:697] unknown reason
932	ok 699 # SKIP [re_tests:699] unknown reason
933	ok 700 # SKIP [re_tests:700] unknown reason
934	ok 701 # SKIP [re_tests:701] unknown reason
935	ok 702 # SKIP [re_tests:702] unknown reason
936	ok 703 # SKIP [re_tests:703] unknown reason
937	ok 704 # SKIP [re_tests:704] unknown reason
938	ok 705 # SKIP [re_tests:705] unknown reason
939	ok 706 # SKIP [re_tests:706] unknown reason
940	ok 707 # SKIP [re_tests:707] unknown reason
941	ok 717 # SKIP [re_tests:717] unknown reason
942	ok 718 # SKIP [re_tests:718] unknown reason
943	ok 719 # SKIP [re_tests:719] unknown reason
944	ok 720 # SKIP [re_tests:720] unknown reason
945	ok 721 # SKIP [re_tests:721] unknown reason
946	ok 722 # SKIP [re_tests:722] unknown reason
947	ok 723 # SKIP [re_tests:723] unknown reason
948	ok 724 # SKIP [re_tests:724] unknown reason
949	ok 725 # SKIP [re_tests:725] unknown reason
950	ok 735 # SKIP [re_tests:735] unknown reason
951	ok 736 # SKIP [re_tests:736] unknown reason
952	ok 737 # SKIP [re_tests:737] unknown reason
953	ok 738 # SKIP [re_tests:738] unknown reason
954	ok 739 # SKIP [re_tests:739] unknown reason
955	ok 740 # SKIP [re_tests:740] unknown reason
956	ok 741 # SKIP [re_tests:741] unknown reason
957	ok 742 # SKIP [re_tests:742] unknown reason
958	ok 743 # SKIP [re_tests:743] unknown reason
959	not ok 747 # TODO [re_tests:747] unknown reason
960	not ok 749 # TODO [re_tests:749] unknown reason
961	not ok 750 # TODO [re_tests:750] unknown reason
962	not ok 751 # TODO [re_tests:751] unknown reason
963	ok 753 # SKIP [re_tests:753] unknown reason
964	ok 754 # SKIP [re_tests:754] unknown reason
965	ok 755 # SKIP [re_tests:755] unknown reason
966	ok 756 # SKIP [re_tests:756] unknown reason
967	ok 757 # SKIP [re_tests:757] unknown reason
968	ok 758 # SKIP [re_tests:758] unknown reason
969	ok 759 # SKIP [re_tests:759] unknown reason
970	ok 760 # SKIP [re_tests:760] unknown reason
971	ok 761 # SKIP [re_tests:761] unknown reason
972	ok 771 # SKIP [re_tests:771] unknown reason
973	ok 772 # SKIP [re_tests:772] unknown reason
974	ok 773 # SKIP [re_tests:773] unknown reason
975	ok 774 # SKIP [re_tests:774] unknown reason
976	ok 775 # SKIP [re_tests:775] unknown reason
977	ok 776 # SKIP [re_tests:776] unknown reason
978	ok 777 # SKIP [re_tests:777] unknown reason
979	ok 778 # SKIP [re_tests:778] unknown reason
980	ok 779 # SKIP [re_tests:779] unknown reason
981	ok 789 # SKIP [re_tests:789] unknown reason
982	ok 790 # SKIP [re_tests:790] unknown reason
983	ok 791 # SKIP [re_tests:791] unknown reason
984	ok 792 # SKIP [re_tests:792] unknown reason
985	ok 793 # SKIP [re_tests:793] unknown reason
986	ok 794 # SKIP [re_tests:794] unknown reason
987	ok 795 # SKIP [re_tests:795] unknown reason
988	ok 796 # SKIP [re_tests:796] unknown reason
989	ok 797 # SKIP [re_tests:797] unknown reason
990	ok 800 # SKIP [re_tests:800]
991	not ok 801 # TODO [re_tests:801] unknown reason
992	ok 802 # SKIP [re_tests:802]
993	ok 803 # SKIP [re_tests:803]
994	ok 805 # SKIP [re_tests:805]
995	ok 806 # SKIP [re_tests:806] hangs a parrot
996	ok 807 # SKIP [re_tests:807] hangs a parrot
997	ok 808 # SKIP [re_tests:808] hangs a parrot
998	ok 809 # SKIP [re_tests:809] hangs a parrot
999	ok 810 # SKIP [re_tests:810] hangs a parrot
1000	ok 811 # SKIP [re_tests:811] hangs a parrot
1001	ok 812 # SKIP [re_tests:812] hangs a parrot
1002	ok 813 # SKIP [re_tests:813] hangs a parrot
1003	ok 814 # SKIP [re_tests:814] hangs a parrot
1004	ok 815 # SKIP [re_tests:815] hangs a parrot
1005	ok 816 # SKIP [re_tests:816] hangs a parrot
1006	ok 817 # SKIP [re_tests:817] hangs a parrot
1007	ok 818 # SKIP [re_tests:818] hangs a parrot
1008	ok 819 # SKIP [re_tests:819] hangs a parrot
1009	ok 820 # SKIP [re_tests:820] hangs a parrot
1010	ok 821 # SKIP [re_tests:821] hangs a parrot
1011	ok 822 # SKIP [re_tests:822] hangs a parrot
1012	ok 823 # SKIP [re_tests:823] hangs a parrot
1013	not ok 827 # TODO [re_tests:827] \d in character class
1014	ok 828 # SKIP [re_tests:828]
1015	ok 829 # SKIP [re_tests:829]
1016	ok 830 # SKIP [re_tests:830]
1017	ok 834 # SKIP [re_tests:834]
1018	ok 835 # SKIP [re_tests:835]
1019	ok 836 # SKIP [re_tests:836]
1020	ok 838 # SKIP [re_tests:838]
1021	not ok 858 # TODO [re_tests:858] unknown reason
1022	ok 859 # SKIP [re_tests:859]
1023	ok 862 # SKIP [re_tests:862]
1024	not ok 865 # TODO [re_tests:865] unknown reason
1025	not ok 866 # TODO [re_tests:866] unknown reason
1026	ok 877 # SKIP [re_tests:877]
1027	ok 879 # SKIP [re_tests:879] [ID 20010811.006]
1028	not ok 881 # TODO [re_tests:881] unknown reason
1029	ok 886 # SKIP [re_tests:886]
1030	not ok 887 # TODO [re_tests:887] unknown reason
1031	not ok 888 # TODO [re_tests:888] unknown reason
1032	not ok 890 # TODO [re_tests:890] unknown reason
1033	not ok 891 # TODO [re_tests:891] unknown reason
1034	not ok 893 # TODO [re_tests:893] unknown reason
1035	not ok 896 # TODO [re_tests:896] unknown reason
1036	not ok 897 # TODO [re_tests:897] unknown reason
1037	not ok 898 # TODO [re_tests:898] unknown reason
1038	not ok 899 # TODO [re_tests:899] unknown reason
1039	not ok 901 # TODO [re_tests:901] greediness/lookbehind
1040	not ok 904 # TODO [re_tests:904] greediness/lookbehind
1041	not ok 905 # TODO [re_tests:905] greediness/lookbehind
1042	not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion
1043	not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion
1044	not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion
1045	not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion
1046	not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion
1047	not ok 915 # TODO [re_tests:915] non-greedy/lookbehind
1048	not ok 916 # TODO [re_tests:916] non-greedy/lookbehind
1049	not ok 918 # TODO [re_tests:918] non-greedy/lookbehind
1050	not ok 921 # TODO [re_tests:921] non-greedy/lookbehind
1051	not ok 922 # TODO [re_tests:922] non-greedy/lookbehind
1052	not ok 923 # TODO [re_tests:923] unmatched bracket
1053	ok 924 # SKIP [re_tests:924]
1054	ok 926 # SKIP [re_tests:926] [perl #18019]
1055	not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171]
1056	not ok 928 # TODO [re_tests:928] reuse captured group
1057	not ok 929 # TODO [re_tests:929] reuse captured group
1058	not ok 930 # TODO [re_tests:930] reuse captured group
1059	not ok 931 # TODO [re_tests:931] reuse captured group
1060	not ok 932 # TODO [re_tests:932] reuse captured group
1061	not ok 933 # TODO [re_tests:933] reuse captured group
1062	not ok 934 # TODO [re_tests:934] reuse captured group
1063	not ok 935 # TODO [re_tests:935] reuse captured group
1064	not ok 936 # TODO [re_tests:936] reuse captured group
1065	not ok 937 # TODO [re_tests:937] reuse captured group
1066	not ok 938 # TODO [re_tests:938] reuse captured group
1067	not ok 939 # TODO [re_tests:939] reuse captured group
1068	not ok 940 # TODO [re_tests:940] reuse captured group
1069	not ok 941 # TODO [re_tests:941] reuse captured group
1070	not ok 942 # TODO [re_tests:942] reuse captured group
1071	ok 944 # SKIP [re_tests:944] unknown reason
1072	ok 945 # SKIP [re_tests:945] unknown reason
1073	ok 957 # SKIP [re_tests:957]
1074	ok 958 # SKIP [re_tests:958]
1075	not ok 959 # TODO [re_tests:959] [perl #34195]
1076	not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion
1077	ok
1078	t/compilers/pge/perl6regex/01-regex....
1079	not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&\|) - parse error
1080	not ok 99 # TODO [rx_metachars:114] null pattern invalid
1081	not ok 386 # TODO [rx_backtrack:4] basic
1082	not ok 427 # TODO [rx_charclass:26] illegal character range
1083	not ok 458 # TODO [rx_charclass:62] literal match (\")
1084	not ok 459 # TODO [rx_charclass:64] literal match (\")
1085	not ok 460 # TODO [rx_charclass:66] literal match with quote
1086	not ok 461 # TODO [rx_charclass:68] literal match with quote
1087	not ok 462 # TODO [rx_charclass:70] literal match with backslash
1088	not ok 463 # TODO [rx_charclass:72] literal match with interpolation
1089	not ok 464 # TODO [rx_charclass:74] literal match with interpolation
1090	not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i)
1091	not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s)
1092	not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s)
1093	not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s)
1094	not ok 709 # TODO [rx_modifiers:131] basic ws match
1095	not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5)
1096	not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth)
1097	not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth)
1098	ok
1099	t/compilers/pge/perl6regex/context.....
1100	not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented
1101	ok
1102	t/compilers/tge/basic..................ok
1103	t/compilers/tge/grammar................
1104	not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug
1105	ok
1106	t/compilers/tge/parser.................ok
1107	t/library/cgi_query_hash...............ok
1108	t/library/coroutine....................ok
1109	t/library/dumper.......................ok
1110	t/library/getopt_obj...................ok
1111	t/library/hllmacros....................ok
1112	t/library/iter.........................ok
1113	t/library/md5..........................ok
1114	t/library/mime_base64..................ok
1115	t/library/mt19937ar....................ok
1116	t/library/p6object.....................
1117	not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) >
1118	ok
1119	t/library/parrotlib....................ok
1120	t/library/pcre.........................
1121	ok 1 # SKIP no pcre-config
1122	ok
1123	t/library/pg...........................
1124	ok 1 # SKIP skipped
1125	ok 2 # SKIP skipped
1126	ok 3 # SKIP skipped
1127	ok 4 # SKIP skipped
1128	ok 5 # SKIP skipped
1129	ok 6 # SKIP skipped
1130	ok 7 # SKIP skipped
1131	ok 8 # SKIP skipped
1132	ok 9 # SKIP skipped
1133	ok 10 # SKIP skipped
1134	ok 11 # SKIP skipped
1135	ok 12 # SKIP skipped
1136	ok 13 # SKIP skipped
1137	ok 14 # SKIP skipped
1138	ok 15 # SKIP skipped
1139	ok 16 # SKIP skipped
1140	ok 17 # SKIP skipped
1141	ok 18 # SKIP skipped
1142	ok 19 # SKIP skipped
1143	ok 20 # SKIP skipped
1144	ok 21 # SKIP skipped
1145	ok 22 # SKIP skipped
1146	ok 23 # SKIP skipped
1147	ok 24 # SKIP skipped
1148	ok 25 # SKIP skipped
1149	ok 26 # SKIP skipped
1150	ok 27 # SKIP skipped
1151	ok 28 # SKIP skipped
1152	ok 29 # SKIP skipped
1153	ok 30 # SKIP skipped
1154	ok 31 # SKIP skipped
1155	ok 32 # SKIP skipped
1156	ok 33 # SKIP skipped
1157	ok 34 # SKIP skipped
1158	ok 35 # SKIP skipped
1159	ok 36 # SKIP skipped
1160	ok 37 # SKIP skipped
1161	ok 38 # SKIP skipped
1162	ok 39 # SKIP skipped
1163	ok 40 # SKIP skipped
1164	ok 41 # SKIP skipped
1165	ok 42 # SKIP skipped
1166	ok 43 # SKIP skipped
1167	ok
1168	t/library/protoobject..................ok
1169	t/library/rand.........................ok
1170	t/library/range........................ok
1171	t/library/streams......................
1172	ok 18 # SKIP broken method invocation
1173	ok 20 # SKIP broken method invocation
1174	ok
1175	t/library/string_utils.................ok
1176	t/library/tcl_glob.....................ok
1177	t/library/tcl_lib......................ok
1178	t/library/test_builder_tester..........ok
1179	t/library/test_class...................ok
1180	t/library/test_more....................ok
1181	t/library/uuid.........................ok
1182	t/library/yaml_dumper..................
1183	not ok 7 - properties # TODO not yet implemented
1184	not ok 8 - indent string # TODO not supported
1185	not ok 9 - back-referencing properties # TODO not yet implemented
1186	not ok 10 - self-referential properties (1) # TODO not yet implemented
1187	not ok 11 - self-referential properties (2) # TODO not yet implemented
1188	not ok 26 - custom dumper # TODO not yet implemented
1189	ok
1190	t/library/yaml_parser_syck.............
1191	not ok 1 - basic parsing # TODO Not properly implemented yet
1192	ok
1193	All tests successful.
1194	Files=252, Tests=8326, 656 wallclock secs ( 6.41 usr 4.34 sys + 193.79 cusr 125.22 csys = 329.76 CPU)
1195	Result: PASS
1196	perl t/harness --gc-debug --running-make-test -C --runcore-tests
1197	t/compilers/imcc/imcpasm/cfg...........ok
1198	t/compilers/imcc/imcpasm/opt0..........
1199	ok 1 # SKIP disabled graph coloring register allocator, RT #57028
1200	ok 3 # SKIP disabled graph coloring register allocator, RT #57028
1201	ok
1202	t/compilers/imcc/imcpasm/opt1..........
1203	ok 76 # SKIP constant concat N/Y
1204	ok
1205	t/compilers/imcc/imcpasm/opt2..........
1206	ok 5 # SKIP loop opt disabled for now
1207	ok
1208	t/compilers/imcc/imcpasm/optc..........
1209	not ok 9 - tailcall 1 # TODO RT #57028
1210	ok
1211	t/compilers/imcc/imcpasm/pcc...........ok
1212	t/compilers/imcc/imcpasm/sub...........ok
1213	t/compilers/imcc/reg/alloc.............ok
1214	t/compilers/imcc/reg/spill.............ok
1215	t/compilers/imcc/syn/bsr...............ok
1216	t/compilers/imcc/syn/clash.............
1217	not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet
1218	ok
1219	t/compilers/imcc/syn/const.............ok
1220	t/compilers/imcc/syn/errors............ok
1221	t/compilers/imcc/syn/eval..............
1222	ok 1 # SKIP changed eval semantics - see t/pmc/eval.t
1223	ok 2 # SKIP changed eval semantics - see t/pmc/eval.t
1224	ok 3 # SKIP changed eval semantics - see t/pmc/eval.t
1225	ok 4 # SKIP changed eval semantics - see t/pmc/eval.t
1226	ok 5 # SKIP changed eval semantics - see t/pmc/eval.t
1227	ok 6 # SKIP changed eval semantics - see t/pmc/eval.t
1228	ok 7 # SKIP changed eval semantics - see t/pmc/eval.t
1229	ok
1230	t/compilers/imcc/syn/file..............
1231	ok 13 # SKIP multiple loading not speced - failing
1232	ok
1233	t/compilers/imcc/syn/hll...............ok
1234	t/compilers/imcc/syn/keyed.............
1235	ok 1 # SKIP experimental
1236	ok
1237	t/compilers/imcc/syn/labels............ok
1238	t/compilers/imcc/syn/macro.............
1239	not ok 25 - unterminated macro 2 # TODO Darwin segfault -- RT #60926
1240	ok
1241	t/compilers/imcc/syn/objects...........ok
1242	t/compilers/imcc/syn/op................ok
1243	t/compilers/imcc/syn/pasm..............ok
1244	t/compilers/imcc/syn/pcc...............ok
1245	t/compilers/imcc/syn/pod...............
1246	ok 4 # SKIP Closing out of pod from included files
1247	ok
1248	t/compilers/imcc/syn/regressions.......
1249	not ok 4 - comments between .param(RT \#46499) # TODO broken
1250	not ok 6 - whitespace between .param(RT \#46499) # TODO broken
1251	not ok 7 - off by one error message (RT \#40204) # TODO broken
1252	ok
1253	t/compilers/imcc/syn/scope.............ok
1254	t/compilers/imcc/syn/subflags..........
1255	not ok 15 # TODO :method sub not found in namespace
1256	ok
1257	t/compilers/imcc/syn/symbols...........ok
1258	t/compilers/imcc/syn/tail..............ok
1259	t/compilers/imcc/syn/veracity..........ok
1260	t/op/00ff-dos..........................ok
1261	t/op/00ff-unix.........................ok
1262	t/op/01-parse_ops......................ok
1263	t/op/64bit.............................
1264	1..0 # Skip 64bit INTVAL platforms only
1265	skipped: 64bit INTVAL platforms only
1266	t/op/annotate..........................ok
1267	t/op/arithmetics.......................
1268	ok 28 # SKIP No integer overflow for 32-bit INTVALs without GMP installed
1269	ok
1270	t/op/basic.............................ok
1271	t/op/bitwise...........................
1272	ok 27 # SKIP no BigInt lib found
1273	ok
1274	t/op/box...............................ok
1275	t/op/calling...........................
1276	not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all
1277	not ok 93 - arg mismatch with no params # TODO RT #39844
1278	ok
1279	t/op/cc_params.........................ok
1280	t/op/cc_state..........................
1281	not ok 6 - positional found, named expected # TODO cc processor state missing
1282	not ok 8 - G2: argument underflow: required slurpy param # TODO failing
1283	ok
1284	t/op/cmp-nonbranch.....................ok
1285	t/op/comp..............................ok
1286	t/op/copy..............................ok
1287	t/op/debuginfo.........................ok
1288	t/op/exceptions........................
1289	not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans
1290	ok
1291	t/op/gc................................ok
1292	t/op/globals...........................ok
1293	t/op/hacks.............................
1294	ok 1 # SKIP no universal SIGFPE handling
1295	ok 2 # SKIP no universal SIGFPE handling
1296	ok
1297	t/op/ifunless..........................ok
1298	t/op/integer...........................ok
1299	t/op/interp............................
1300	ok 1 # SKIP we really shouldn't run just a label - use a sub
1301	ok
1302	t/op/io................................ok
1303	t/op/jit...............................ok
1304	t/op/jitn..............................ok
1305	t/op/lexicals..........................
1306	not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented
1307	ok
1308	t/op/literal...........................ok
1309	t/op/load_bytecode.....................ok
1310	t/op/number............................ok
1311	t/op/pushaction........................
1312	not ok 7 - pushaction: error while handling error # TODO runloop shenanigans
1313	ok
1314	t/op/say...............................ok
1315	t/op/spawnw............................ok
1316	t/op/sprintf...........................
1317	ok 5 # SKIP parrot extension (%B)
1318	ok 7 # SKIP perl5-specific extension (%D)
1319	ok 9 # SKIP perl5-specific extension (%F)
1320	ok 16 # SKIP parrot extension (%H)
1321	ok 20 # SKIP parrot extension (%L)
1322	ok 23 # SKIP perl5-specific extension (%O)
1323	ok 24 # SKIP parrot extension (%P)
1324	ok 27 # SKIP parrot extension (%S)
1325	ok 29 # SKIP perl5-specific extension (%U)
1326	not ok 64 # TODO [%03.2d] actual: > 01<
1327	ok 71 # SKIP perl5-specific extension (%v...)
1328	ok 72 # SKIP perl5-specific extension (%v...)
1329	ok 73 # SKIP perl5-specific extension (%v...)
1330	ok 74 # SKIP perl5-specific extension (%v...)
1331	ok 75 # SKIP perl5-specific extension (%v...)
1332	ok 76 # SKIP perl5-specific extension (%v...)
1333	ok 77 # SKIP perl5-specific extension (%v...)
1334	ok 78 # SKIP perl5-specific extension (%v...)
1335	ok 79 # SKIP perl5-specific extension (%v...)
1336	ok 80 # SKIP perl5-specific extension (%v...)
1337	ok 81 # SKIP perl5-specific extension (%v...)
1338	ok 82 # SKIP perl5-specific extension (%v...)
1339	ok 83 # SKIP perl5-specific extension (%v...)
1340	ok 84 # SKIP perl5-specific extension (%v...)
1341	ok 85 # SKIP perl5-specific extension (%v...)
1342	ok 86 # SKIP perl5-specific extension (%v...)
1343	ok 87 # SKIP perl5-specific extension (%v...)
1344	ok 88 # SKIP perl5-specific extension (%v...)
1345	ok 89 # SKIP perl5-specific extension (%v...)
1346	ok 90 # SKIP perl5-specific extension (%v...)
1347	ok 91 # SKIP perl5-specific extension (%v...)
1348	ok 92 # SKIP perl5-specific extension (%v...)
1349	ok 93 # SKIP perl5-specific extension (%v...)
1350	ok 94 # SKIP perl5-specific extension (%v...)
1351	ok 95 # SKIP perl5-specific extension (%v...)
1352	ok 96 # SKIP perl5-specific extension (%v...)
1353	ok 97 # SKIP perl5-specific extension (%v...)
1354	ok 98 # SKIP perl5-specific extension (%v...)
1355	ok 99 # SKIP perl5-specific extension (%v...)
1356	ok 114 # SKIP harness needs support for * modifier
1357	ok 131 # SKIP harness needs support for * modifier
1358	ok 141 # SKIP harness needs support for * modifier
1359	ok 144 # SKIP perl5 expresssion as test value
1360	not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1<
1361	ok 161 # SKIP harness needs support for * modifier
1362	ok 166 # SKIP harness needs support for * modifier
1363	not ok 187 # TODO [%h] actual: ><
1364	not ok 191 # TODO [%l] actual: ><
1365	ok 193 # SKIP perl5-specific test
1366	ok 200 # SKIP perl5-specific test
1367	ok 201 # SKIP perl5-specific test
1368	ok 202 # SKIP parrot extension (%p)
1369	ok 204 # SKIP parrot extension (%r)
1370	ok 210 # SKIP harness needs support for * modifier
1371	ok 214 # SKIP harness needs support for * modifier
1372	not ok 223 # TODO [%v] actual: ><
1373	ok 233 # SKIP harness needs support for * modifier
1374	ok 234 # SKIP perl5-specific extension (%v...)
1375	ok 235 # SKIP perl5-specific extension (%v...)
1376	ok 238 # SKIP perl5-specific test
1377	ok 239 # SKIP perl5-specific test
1378	ok 240 # SKIP perl5-specific test
1379	ok 241 # SKIP perl5-specific test
1380	ok 242 # SKIP perl5-specific test
1381	ok 243 # SKIP perl5-specific test
1382	ok 244 # SKIP perl5-specific test
1383	ok 245 # SKIP perl5-specific test
1384	ok 246 # SKIP perl5-specific test
1385	ok 247 # SKIP perl5-specific test
1386	ok 248 # SKIP perl5-specific test
1387	ok 249 # SKIP perl5-specific test
1388	ok 250 # SKIP perl5-specific test
1389	ok 251 # SKIP perl5-specific test
1390	ok 252 # SKIP perl5-specific extension (%v...)
1391	ok 253 # SKIP perl5-specific extension (%v...)
1392	ok 254 # SKIP perl5-specific extension (%v...)
1393	ok 255 # SKIP perl5-specific extension (%v...)
1394	ok 256 # SKIP perl5-specific extension (%v...)
1395	ok 257 # SKIP perl5-specific extension (%v...)
1396	ok 258 # SKIP perl5-specific extension (%v...)
1397	ok 259 # SKIP perl5-specific extension (%v...)
1398	ok 260 # SKIP perl5-specific extension (%v...)
1399	ok 261 # SKIP perl5-specific extension (%v...)
1400	ok 262 # SKIP perl5-specific extension (%v...)
1401	ok 263 # SKIP perl5-specific extension (%v...)
1402	ok 264 # SKIP perl5-specific extension (%v...)
1403	ok 265 # SKIP perl5-specific extension (%v...)
1404	ok 266 # SKIP perl5-specific extension (%v...)
1405	ok 267 # SKIP perl5-specific extension (%v...)
1406	ok 268 # SKIP perl5-specific extension (%v...)
1407	ok 269 # SKIP perl5-specific extension (%v...)
1408	ok 270 # SKIP perl5-specific extension (%v...)
1409	ok 271 # SKIP perl5-specific extension (%v...)
1410	ok 272 # SKIP perl5-specific extension (%v...)
1411	ok 273 # SKIP perl5-specific extension (%v...)
1412	ok 274 # SKIP perl5-specific extension (%v...)
1413	ok 275 # SKIP perl5-specific extension (%v...)
1414	ok 276 # SKIP perl5-specific extension (%v...)
1415	ok 277 # SKIP perl5-specific extension (%v...)
1416	ok 278 # SKIP perl5-specific extension (%v...)
1417	ok 279 # SKIP perl5-specific extension (%v...)
1418	ok 280 # SKIP perl5-specific extension (%v...)
1419	ok 281 # SKIP perl5-specific extension (%v...)
1420	ok 282 # SKIP perl5-specific extension (%v...)
1421	ok 283 # SKIP perl5-specific extension (%v...)
1422	ok 284 # SKIP perl5-specific extension (%v...)
1423	ok 285 # SKIP perl5-specific extension (%v...)
1424	ok 286 # SKIP perl5-specific extension (%v...)
1425	ok 287 # SKIP perl5-specific extension (%v...)
1426	ok 288 # SKIP perl5-specific extension (%v...)
1427	ok 289 # SKIP perl5-specific extension (%v...)
1428	ok 290 # SKIP perl5-specific extension (%v...)
1429	ok 291 # SKIP perl5-specific extension (%v...)
1430	ok 292 # SKIP perl5-specific extension (%v...)
1431	ok 293 # SKIP perl5-specific extension (%v...)
1432	ok 294 # SKIP perl5-specific extension (%v...)
1433	ok 295 # SKIP perl5-specific extension (%v...)
1434	ok 296 # SKIP perl5-specific extension (%v...)
1435	ok 297 # SKIP perl5-specific extension (%v...)
1436	ok 298 # SKIP perl5-specific extension (%v...)
1437	ok 300 # SKIP harness needs support for * modifier
1438	not ok 304 # TODO [%#b] actual: >0b0<
1439	not ok 305 # TODO [%#o] actual: >00<
1440	not ok 306 # TODO [%#x] actual: >0x0<
1441	ok 307 # SKIP perl5-specific extension (%v...)
1442	ok 308 # SKIP perl5-specific extension (%v...)
1443	ok
1444	t/op/sprintf2..........................ok
1445	t/op/string............................
1446	ok 103 # SKIP Pending rework of creating non-ascii literals
1447	ok 104 # SKIP Pending rework of creating non-ascii literals
1448	ok 118 # SKIP Pending reimplementation of find_encoding
1449	ok 119 # SKIP no more visible encoding
1450	ok 137 # SKIP No unicode yet
1451	ok 139 # SKIP no more transcode
1452	ok 140 # SKIP no more chartype
1453	ok
1454	t/op/string_cclass.....................
1455	ok 7 # SKIP unicode support unavailable
1456	ok 8 # SKIP unicode support unavailable
1457	ok 9 # SKIP unicode support unavailable
1458	ok
1459	t/op/string_cs.........................
1460	ok 31 # SKIP no ICU lib
1461	ok 32 # SKIP no ICU lib
1462	ok 33 # SKIP no ICU lib
1463	ok 34 # SKIP no ICU lib
1464	ok 35 # SKIP no ICU lib
1465	ok 36 # SKIP no ICU lib
1466	ok 37 # SKIP no ICU lib
1467	ok 38 # SKIP no ICU lib
1468	ok 39 # SKIP no ICU lib
1469	ok 40 # SKIP no ICU lib
1470	ok 41 # SKIP no ICU lib
1471	ok 42 # SKIP no ICU lib
1472	ok 43 # SKIP no ICU lib
1473	ok 44 # SKIP no ICU lib
1474	ok 45 # SKIP no ICU lib
1475	ok 46 # SKIP no ICU lib
1476	ok
1477	t/op/string_mem........................ok
1478	t/op/stringu...........................
1479	ok 20 # SKIP no ICU lib
1480	ok 21 # SKIP no ICU lib
1481	ok 22 # SKIP no ICU lib
1482	ok 25 # SKIP Tests seem to fail on big endian machines with icu
1483	ok 26 # SKIP Tests seem to fail on big endian machines with icu
1484	not ok 27 - UTF-8 and Unicode literals # TODO TT #24
1485	ok
1486	t/op/sysinfo...........................
1487	not ok 11 - sysinfo OS version string # TODO Not Currently Implemented
1488	not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented
1489	ok 13 # SKIP Requires a lot of work to find out the correct answer
1490	ok 14 # SKIP Testing only in some known platforms
1491	ok
1492	t/op/time..............................ok
1493	t/op/trans.............................ok
1494	t/pmc/addrregistry.....................ok
1495	t/pmc/array............................
1496	not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken
1497	ok
1498	t/pmc/bigint...........................
1499	1..0 # Skip No BigInt Lib configured
1500	skipped: No BigInt Lib configured
1501	t/pmc/bignum...........................
1502	1..0 # Skip No BigNum PMC enabled
1503	skipped: No BigNum PMC enabled
1504	t/pmc/boolean..........................ok
1505	t/pmc/bound_nci........................ok
1506	t/pmc/callsignature....................ok
1507	t/pmc/capture..........................ok
1508	t/pmc/class............................
1509	not ok 28 # TODO add_method() invoking method added to class works
1510	ok
1511	t/pmc/codestring.......................ok
1512	t/pmc/complex..........................
1513	ok 58 # SKIP div by zero not caught
1514	ok 59 # SKIP div by zero not caught
1515	ok 60 # SKIP div by zero not caught
1516	ok 86 # SKIP instantiate n/y
1517	ok 87 # SKIP instantiate n/y
1518	ok 88 # SKIP instantiate n/y
1519	ok 89 # SKIP instantiate n/y
1520	ok 126 # SKIP inf is not platform-independent
1521	ok 465 # SKIP add using subclass of Complex - RT #59630
1522	ok 466 # SKIP add using subclass of Complex - RT #59630
1523	ok 467 # SKIP add using subclass of Complex - RT #59630
1524	ok
1525	t/pmc/config...........................ok
1526	t/pmc/continuation.....................ok
1527	t/pmc/coroutine........................
1528	not ok 9 - Call an exited coroutine # TODO goes one iteration too far.
1529	ok
1530	t/pmc/cpointer.........................ok
1531	t/pmc/default..........................
1532	not ok 1 - new # TODO not implemeted
1533	ok
1534	t/pmc/env..............................ok
1535	t/pmc/eval.............................ok
1536	t/pmc/eventhandler.....................ok
1537	t/pmc/exception........................
1538	not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans
1539	not ok 25 - pushaction: error while handling error # TODO runloop shenanigans
1540	not ok 27 - invoke handler in calling sub # TODO deprecate rethrow
1541	ok 30 - catch ex from C-level MULTI function # TODO broken
1542	ok
1543	t/pmc/exceptionhandler.................ok
1544	t/pmc/exporter.........................ok
1545	t/pmc/file.............................ok
1546	t/pmc/filehandle.......................
1547	ok 3 # SKIP no asynch calls yet
1548	not ok 8 - record_separator # TODO not yet implemented
1549	ok
1550	t/pmc/fixedbooleanarray................ok
1551	t/pmc/fixedfloatarray..................ok
1552	t/pmc/fixedintegerarray................ok
1553	t/pmc/fixedpmcarray....................ok
1554	t/pmc/fixedstringarray.................ok
1555	t/pmc/float............................ok
1556	t/pmc/freeze...........................ok
1557	t/pmc/globals..........................ok
1558	t/pmc/hash.............................ok
1559	t/pmc/integer..........................ok
1560	t/pmc/io...............................
1561	not ok 1 - IO on some invalid types # TODO IO on some invalid types
1562	ok 8 # SKIP clone not finished yet
1563	not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433
1564	not ok 40 - string read/write handle # TODO no stringhandle yet
1565	ok
1566	t/pmc/io_iterator......................
1567	not ok 1 - new # TODO not yet implemented
1568	not ok 2 - shift # TODO not yet implemented
1569	not ok 3 - get_bool (vtable) # TODO not yet implemented
1570	ok
1571	t/pmc/io_status........................
1572	not ok 1 - new # TODO not yet implemented
1573	not ok 2 - get_integer (vtable) # TODO not yet implemented
1574	not ok 3 - get_bool (vtable) # TODO not yet implemented
1575	not ok 4 - return # TODO not yet implemented
1576	not ok 5 - error # TODO not yet implemented
1577	not ok 6 - throw # TODO not yet implemented
1578	ok
1579	t/pmc/iterator.........................
1580	ok 13 # SKIP N/Y: length of rest of array
1581	not ok 16 - adding keys during iteration # TODO adding keys during iteration
1582	not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points'
1583	ok
1584	t/pmc/key..............................
1585	not ok 10 # TODO register and non-register string keys should be COW (RT #60128)
1586	ok
1587	t/pmc/lexinfo..........................ok
1588	t/pmc/lexpad...........................ok
1589	t/pmc/managedstruct....................ok
1590	t/pmc/multidispatch....................
1591	not ok 22 - MMD on PMC types - Any # TODO RT #41374
1592	not ok 25 - add as method - inherited # TODO RT #41374
1593	not ok 32 - use a core func for an object # TODO RT #59628
1594	ok
1595	t/pmc/multisub.........................ok
1596	t/pmc/namespace........................
1597	not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17
1598	ok
1599	t/pmc/nci..............................ok
1600	t/pmc/null.............................ok
1601	t/pmc/object-meths.....................
1602	ok 14 # SKIP currently broken
1603	ok 25 # SKIP no bound NCI method
1604	ok
1605	t/pmc/object-mro.......................ok
1606	t/pmc/object...........................ok
1607	t/pmc/objects..........................ok
1608	t/pmc/orderedhash......................ok
1609	t/pmc/os...............................ok
1610	t/pmc/packfile.........................ok
1611	t/pmc/packfileconstanttable............
1612	not ok 3 - get_type, get_*_keyed_int # TODO See TT #385.
1613	ok
1614	t/pmc/packfiledirectory................ok
1615	t/pmc/packfilefixupentry...............ok
1616	t/pmc/packfilefixuptable...............ok
1617	t/pmc/packfilerawsegment...............ok
1618	t/pmc/packfilesegment..................ok
1619	t/pmc/parrotclass......................ok
1620	t/pmc/parrotinterpreter................ok
1621	t/pmc/parrotio.........................
1622	not ok 2 - open and close - synchronous # TODO not yet implemented
1623	ok 3 # SKIP no asynch calls yet
1624	not ok 4 - print, read, and readline - synchronous # TODO not yet implemented
1625	not ok 5 - record_separator # TODO not yet implemented
1626	not ok 6 - buffer_type # TODO not yet implemented
1627	ok
1628	t/pmc/parrotlibrary....................ok
1629	t/pmc/parrotobject.....................ok
1630	t/pmc/parrotrunningthread..............ok
1631	t/pmc/parrotthread.....................ok
1632	t/pmc/pccmethod_test...................ok
1633	t/pmc/pmc..............................ok
1634	t/pmc/pmcproxy.........................ok
1635	t/pmc/pointer..........................ok
1636	t/pmc/prop.............................ok
1637	t/pmc/random...........................ok
1638	t/pmc/ref..............................ok
1639	t/pmc/resizablebooleanarray............ok
1640	t/pmc/resizablefloatarray..............ok
1641	t/pmc/resizableintegerarray............ok
1642	t/pmc/resizablepmcarray................ok
1643	t/pmc/resizablestringarray.............ok
1644	t/pmc/retcontinuation..................ok
1645	t/pmc/ro...............................
1646	not ok 8 - ResizablePMCArray -- Recursive # TODO 1
1647	ok
1648	t/pmc/role.............................ok
1649	t/pmc/scalar...........................
1650	ok 1 # SKIP doesn't work yet
1651	ok
1652	t/pmc/scheduler........................ok
1653	t/pmc/schedulermessage.................ok
1654	t/pmc/sharedref........................ok
1655	t/pmc/signal...........................
1656	1..0 # Skip Signals currently disabled
1657	skipped: Signals currently disabled
1658	t/pmc/slice............................
1659	not ok 2 - bug with slice bits # TODO parser
1660	ok
1661	t/pmc/string...........................ok
1662	t/pmc/stringhandle.....................
1663	ok 3 # SKIP no asynch calls yet
1664	not ok 9 - record_separator # TODO not yet implemented
1665	ok
1666	t/pmc/sub..............................ok
1667	t/pmc/sys..............................ok
1668	t/pmc/task.............................ok
1669	t/pmc/threads..........................
1670	not ok 11 - CLONE_CODE \| CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511
1671	not ok 14 - globals + constant table subs issue # TODO Broken with CGP
1672	not ok 15 - CLONE_CODE\|CLONE_GLOBALS\|CLONE_HLL\|CLONE_LIBRARIES # TODO RT #41373
1673	ok
1674	t/pmc/timer............................ok
1675	t/pmc/undef............................ok
1676	t/pmc/unmanagedstruct..................ok
1677	t/oo/attributes........................ok
1678	t/oo/composition.......................ok
1679	t/oo/inheritance.......................ok
1680	t/oo/isa...............................ok
1681	t/oo/metamodel.........................
1682	not ok 6 # TODO tail attribute has a type
1683	not ok 12 # TODO new opcode makes working objects
1684	ok
1685	t/oo/methods...........................ok
1686	t/oo/mro-c3............................ok
1687	t/oo/names.............................ok
1688	t/oo/new...............................ok
1689	t/oo/ops...............................ok
1690	t/oo/proxy.............................ok
1691	t/oo/subclass..........................ok
1692	t/oo/vtableoverride....................ok
1693	t/native_pbc/header....................
1694	1..0 # Skip pending robust testing strategy, TT #357
1695	skipped: pending robust testing strategy, TT #357
1696	t/native_pbc/integer...................
1697	1..0 # Skip pending robust testing strategy, TT #357
1698	skipped: pending robust testing strategy, TT #357
1699	t/native_pbc/number....................
1700	1..0 # Skip pending robust testing strategy, TT #357
1701	skipped: pending robust testing strategy, TT #357
1702	t/native_pbc/string....................
1703	1..0 # Skip pending robust testing strategy, TT #357
1704	skipped: pending robust testing strategy, TT #357
1705	t/dynpmc/dynlexpad.....................
1706	not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads
1707	ok
1708	t/dynpmc/foo...........................
1709	ok 6 # SKIP No BigInt Lib configured
1710	ok
1711	t/dynpmc/gdbmhash......................
1712	1..0 # Skip No gdbm library available
1713	skipped: No gdbm library available
1714	t/dynpmc/md2...........................ok
1715	t/dynpmc/md4...........................ok
1716	t/dynpmc/md5...........................ok
1717	t/dynpmc/pair..........................ok
1718	t/dynpmc/rational......................ok
1719	t/dynpmc/ripemd160.....................ok
1720	t/dynpmc/rotest........................ok
1721	t/dynpmc/sha...........................ok
1722	t/dynpmc/sha1..........................ok
1723	t/dynpmc/sha256........................
1724	1..0 # Skip Too old library
1725	skipped: Too old library
1726	t/dynpmc/sha512........................
1727	1..0 # Skip Too old library
1728	skipped: Too old library
1729	t/dynpmc/subclass_with_pir_method......
1730	not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces
1731	not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces
1732	ok
1733	t/dynpmc/subproxy......................ok
1734	t/dynoplibs/dan........................ok
1735	t/dynoplibs/myops......................ok
1736	t/compilers/pct/complete_workflow......ok
1737	t/compilers/pct/past...................ok
1738	t/compilers/pct/pct_hllcompiler........ok
1739	t/compilers/pct/post...................ok
1740	t/compilers/pge/00-basic...............ok
1741	t/compilers/pge/02-match...............ok
1742	t/compilers/pge/03-optable.............ok
1743	t/compilers/pge/04-compile.............ok
1744	t/compilers/pge/06-grammar.............ok
1745	t/compilers/pge/pge-hs.................ok
1746	t/compilers/pge/pge....................ok
1747	t/compilers/pge/pge_examples...........ok
1748	t/compilers/pge/pge_globs..............ok
1749	t/compilers/pge/pge_text...............ok
1750	t/compilers/pge/pge_util...............ok
1751	t/compilers/pge/p5regex/p5rx...........
1752	not ok 116 # TODO [re_tests:116] character class in enumeration
1753	not ok 119 # TODO [re_tests:119] character class in enumeration
1754	not ok 120 # TODO [re_tests:120] character class in enumeration
1755	not ok 123 # TODO [re_tests:123] character class in enumeration
1756	not ok 124 # TODO [re_tests:124] character class in enumeration
1757	not ok 127 # TODO [re_tests:127] character class in enumeration
1758	ok 138 # SKIP [re_tests:138] parser bug
1759	ok 139 # SKIP [re_tests:139] broken col 4?
1760	ok 143 # SKIP [re_tests:143] bug or error
1761	ok 144 # SKIP [re_tests:144] bug or error
1762	ok 148 # SKIP [re_tests:148] bug or error
1763	ok 149 # SKIP [re_tests:149] bug or error
1764	ok 155 # SKIP [re_tests:155] bug or error
1765	ok 167 # SKIP [re_tests:167] bug or error
1766	not ok 234 # TODO [re_tests:234] unknown reason
1767	not ok 235 # TODO [re_tests:235] unknown reason
1768	not ok 236 # TODO [re_tests:236] unknown reason
1769	not ok 246 # TODO [re_tests:246] unknown reason
1770	not ok 247 # TODO [re_tests:247] unknown reason
1771	ok 248 # SKIP [re_tests:248] bug or error
1772	ok 249 # SKIP [re_tests:249] bug or error
1773	ok 252 # SKIP [re_tests:252] bug or error
1774	not ok 254 # TODO [re_tests:254] unknown reason
1775	not ok 256 # TODO [re_tests:256] unknown reason
1776	not ok 257 # TODO [re_tests:257] unknown reason
1777	ok 264 # SKIP [re_tests:264] trailing modifiers
1778	ok 265 # SKIP [re_tests:265] trailing modifiers
1779	ok 266 # SKIP [re_tests:266] trailing modifiers
1780	ok 267 # SKIP [re_tests:267] trailing modifiers
1781	ok 268 # SKIP [re_tests:268] trailing modifiers
1782	ok 269 # SKIP [re_tests:269] trailing modifiers
1783	ok 270 # SKIP [re_tests:270] trailing modifiers
1784	ok 271 # SKIP [re_tests:271] trailing modifiers
1785	ok 272 # SKIP [re_tests:272] trailing modifiers
1786	ok 273 # SKIP [re_tests:273] trailing modifiers
1787	ok 274 # SKIP [re_tests:274] trailing modifiers
1788	ok 275 # SKIP [re_tests:275] trailing modifiers
1789	ok 276 # SKIP [re_tests:276] trailing modifiers
1790	ok 277 # SKIP [re_tests:277] trailing modifiers
1791	ok 278 # SKIP [re_tests:278] trailing modifiers
1792	ok 279 # SKIP [re_tests:279] trailing modifiers
1793	ok 280 # SKIP [re_tests:280] trailing modifiers
1794	ok 281 # SKIP [re_tests:281] trailing modifiers
1795	ok 282 # SKIP [re_tests:282] trailing modifiers
1796	ok 283 # SKIP [re_tests:283] trailing modifiers
1797	ok 284 # SKIP [re_tests:284] trailing modifiers
1798	ok 285 # SKIP [re_tests:285] trailing modifiers
1799	ok 286 # SKIP [re_tests:286] trailing modifiers
1800	ok 287 # SKIP [re_tests:287] trailing modifiers
1801	ok 288 # SKIP [re_tests:288] trailing modifiers
1802	ok 289 # SKIP [re_tests:289] trailing modifiers
1803	ok 290 # SKIP [re_tests:290] trailing modifiers
1804	ok 291 # SKIP [re_tests:291] trailing modifiers
1805	ok 292 # SKIP [re_tests:292] trailing modifiers
1806	ok 293 # SKIP [re_tests:293] trailing modifiers
1807	ok 294 # SKIP [re_tests:294] trailing modifiers
1808	ok 295 # SKIP [re_tests:295] trailing modifiers
1809	ok 296 # SKIP [re_tests:296] trailing modifiers
1810	ok 297 # SKIP [re_tests:297] trailing modifiers
1811	ok 298 # SKIP [re_tests:298] trailing modifiers
1812	ok 299 # SKIP [re_tests:299] trailing modifiers
1813	ok 300 # SKIP [re_tests:300] trailing modifiers
1814	ok 301 # SKIP [re_tests:301] trailing modifiers
1815	ok 302 # SKIP [re_tests:302] trailing modifiers
1816	ok 303 # SKIP [re_tests:303] trailing modifiers
1817	ok 304 # SKIP [re_tests:304] trailing modifiers
1818	ok 305 # SKIP [re_tests:305] trailing modifiers
1819	ok 306 # SKIP [re_tests:306] trailing modifiers
1820	ok 307 # SKIP [re_tests:307] trailing modifiers
1821	ok 308 # SKIP [re_tests:308] bug or error
1822	ok 309 # SKIP [re_tests:309] bug or error
1823	ok 310 # SKIP [re_tests:310] bug or error
1824	ok 311 # SKIP [re_tests:311] trailing modifiers
1825	ok 312 # SKIP [re_tests:312] trailing modifiers
1826	ok 313 # SKIP [re_tests:313] trailing modifiers
1827	ok 314 # SKIP [re_tests:314] trailing modifiers
1828	ok 315 # SKIP [re_tests:315] trailing modifiers
1829	ok 316 # SKIP [re_tests:316] trailing modifiers
1830	ok 317 # SKIP [re_tests:317] trailing modifiers
1831	ok 318 # SKIP [re_tests:318] trailing modifiers
1832	ok 319 # SKIP [re_tests:319] trailing modifiers
1833	ok 320 # SKIP [re_tests:320] trailing modifiers
1834	ok 321 # SKIP [re_tests:321] trailing modifiers
1835	ok 322 # SKIP [re_tests:322] bug or error
1836	ok 323 # SKIP [re_tests:323] bug or error
1837	ok 324 # SKIP [re_tests:324] trailing modifiers
1838	ok 325 # SKIP [re_tests:325] bug or error
1839	ok 326 # SKIP [re_tests:326] trailing modifiers
1840	ok 327 # SKIP [re_tests:327] trailing modifiers
1841	ok 328 # SKIP [re_tests:328] trailing modifiers
1842	ok 329 # SKIP [re_tests:329] trailing modifiers
1843	ok 330 # SKIP [re_tests:330] bug or error
1844	ok 331 # SKIP [re_tests:331] bug or error
1845	ok 332 # SKIP [re_tests:332] trailing modifiers
1846	ok 333 # SKIP [re_tests:333] trailing modifiers
1847	ok 334 # SKIP [re_tests:334] trailing modifiers
1848	ok 335 # SKIP [re_tests:335] trailing modifiers
1849	ok 336 # SKIP [re_tests:336] bug or error
1850	ok 337 # SKIP [re_tests:337] trailing modifiers
1851	ok 338 # SKIP [re_tests:338] trailing modifiers
1852	ok 339 # SKIP [re_tests:339] trailing modifiers
1853	ok 340 # SKIP [re_tests:340] trailing modifiers
1854	ok 341 # SKIP [re_tests:341] trailing modifiers
1855	ok 342 # SKIP [re_tests:342] trailing modifiers
1856	ok 343 # SKIP [re_tests:343] trailing modifiers
1857	ok 344 # SKIP [re_tests:344] trailing modifiers
1858	ok 345 # SKIP [re_tests:345] trailing modifiers
1859	ok 346 # SKIP [re_tests:346] trailing modifiers
1860	ok 347 # SKIP [re_tests:347] bug or error
1861	ok 348 # SKIP [re_tests:348] trailing modifiers
1862	ok 349 # SKIP [re_tests:349] trailing modifiers
1863	ok 350 # SKIP [re_tests:350] trailing modifiers
1864	ok 351 # SKIP [re_tests:351] trailing modifiers
1865	ok 352 # SKIP [re_tests:352] trailing modifiers
1866	ok 353 # SKIP [re_tests:353] trailing modifiers
1867	ok 354 # SKIP [re_tests:354] trailing modifiers
1868	ok 355 # SKIP [re_tests:355] trailing modifiers
1869	ok 356 # SKIP [re_tests:356] trailing modifiers
1870	ok 357 # SKIP [re_tests:357] trailing modifiers
1871	ok 358 # SKIP [re_tests:358] trailing modifiers
1872	ok 359 # SKIP [re_tests:359] trailing modifiers
1873	ok 360 # SKIP [re_tests:360] trailing modifiers
1874	ok 361 # SKIP [re_tests:361] trailing modifiers
1875	ok 362 # SKIP [re_tests:362] trailing modifiers
1876	ok 363 # SKIP [re_tests:363] trailing modifiers
1877	ok 364 # SKIP [re_tests:364] trailing modifiers
1878	ok 365 # SKIP [re_tests:365] trailing modifiers
1879	ok 366 # SKIP [re_tests:366] trailing modifiers
1880	ok 367 # SKIP [re_tests:367] trailing modifiers
1881	ok 368 # SKIP [re_tests:368] trailing modifiers
1882	ok 369 # SKIP [re_tests:369] trailing modifiers
1883	ok 370 # SKIP [re_tests:370] trailing modifiers
1884	ok 371 # SKIP [re_tests:371] trailing modifiers
1885	ok 372 # SKIP [re_tests:372] trailing modifiers
1886	ok 373 # SKIP [re_tests:373] trailing modifiers
1887	ok 374 # SKIP [re_tests:374] trailing modifiers
1888	ok 375 # SKIP [re_tests:375] trailing modifiers
1889	ok 376 # SKIP [re_tests:376] trailing modifiers
1890	ok 377 # SKIP [re_tests:377] trailing modifiers
1891	ok 378 # SKIP [re_tests:378] trailing modifiers
1892	ok 379 # SKIP [re_tests:379] trailing modifiers
1893	ok 380 # SKIP [re_tests:380] trailing modifiers
1894	ok 381 # SKIP [re_tests:381] trailing modifiers
1895	ok 382 # SKIP [re_tests:382] trailing modifiers
1896	ok 383 # SKIP [re_tests:383] trailing modifiers
1897	ok 384 # SKIP [re_tests:384] trailing modifiers
1898	ok 385 # SKIP [re_tests:385] trailing modifiers
1899	ok 386 # SKIP [re_tests:386] trailing modifiers
1900	ok 387 # SKIP [re_tests:387] trailing modifiers
1901	ok 388 # SKIP [re_tests:388] trailing modifiers
1902	ok 389 # SKIP [re_tests:389] trailing modifiers
1903	ok 390 # SKIP [re_tests:390] trailing modifiers
1904	ok 391 # SKIP [re_tests:391] trailing modifiers
1905	ok 392 # SKIP [re_tests:392] trailing modifiers
1906	ok 393 # SKIP [re_tests:393] trailing modifiers
1907	ok 394 # SKIP [re_tests:394] trailing modifiers
1908	ok 395 # SKIP [re_tests:395] trailing modifiers
1909	not ok 396 # TODO [re_tests:396] unknown reason
1910	not ok 397 # TODO [re_tests:397] unknown reason
1911	not ok 398 # TODO [re_tests:398] unknown reason
1912	ok 408 # SKIP [re_tests:408] bug or error
1913	not ok 419 # TODO [re_tests:419] unknown reason
1914	not ok 422 # TODO [re_tests:422] unknown reason
1915	not ok 429 # TODO [re_tests:429] unknown reason
1916	not ok 432 # TODO [re_tests:432] unknown reason
1917	not ok 434 # TODO [re_tests:434] unknown reason
1918	not ok 435 # TODO [re_tests:435] unknown reason
1919	ok 436 # SKIP [re_tests:436] bug or error
1920	not ok 439 # TODO [re_tests:439] unknown reason
1921	not ok 446 # TODO [re_tests:446] unknown reason
1922	not ok 447 # TODO [re_tests:447] unknown reason
1923	not ok 448 # TODO [re_tests:448] unknown reason
1924	not ok 449 # TODO [re_tests:449] unknown reason
1925	not ok 452 # TODO [re_tests:452] unknown reason
1926	not ok 453 # TODO [re_tests:453] unknown reason
1927	not ok 454 # TODO [re_tests:454] unknown reason
1928	not ok 455 # TODO [re_tests:455] unknown reason
1929	ok 458 # SKIP [re_tests:458] unknown reason
1930	ok 459 # SKIP [re_tests:459] unknown reason
1931	ok 460 # SKIP [re_tests:460] unknown reason
1932	ok 461 # SKIP [re_tests:461] unknown reason
1933	ok 462 # SKIP [re_tests:462] unknown reason
1934	ok 463 # SKIP [re_tests:463] unknown reason
1935	ok 464 # SKIP [re_tests:464] unknown reason
1936	ok 465 # SKIP [re_tests:465] unknown reason
1937	ok 466 # SKIP [re_tests:466] unknown reason
1938	ok 467 # SKIP [re_tests:467] unknown reason
1939	ok 468 # SKIP [re_tests:468] unknown reason
1940	ok 469 # SKIP [re_tests:469] unknown reason
1941	ok 470 # SKIP [re_tests:470] unknown reason
1942	ok 471 # SKIP [re_tests:471] unknown reason
1943	ok 472 # SKIP [re_tests:472] unknown reason
1944	ok 473 # SKIP [re_tests:473] unknown reason
1945	ok 474 # SKIP [re_tests:474] unknown reason
1946	ok 475 # SKIP [re_tests:475] unknown reason
1947	ok 476 # SKIP [re_tests:476] unknown reason
1948	ok 477 # SKIP [re_tests:477] unknown reason
1949	ok 478 # SKIP [re_tests:478] unknown reason
1950	ok 479 # SKIP [re_tests:479] unknown reason
1951	ok 480 # SKIP [re_tests:480] unknown reason
1952	ok 483 # SKIP [re_tests:483]
1953	ok 484 # SKIP [re_tests:484]
1954	ok 487 # SKIP [re_tests:487] bug or error
1955	ok 488 # SKIP [re_tests:488] bug or error
1956	ok 489 # SKIP [re_tests:489] bug or error
1957	ok 490 # SKIP [re_tests:490] bug or error
1958	ok 491 # SKIP [re_tests:491] kills a parrot
1959	ok 492 # SKIP [re_tests:492] bug or error
1960	ok 493 # SKIP [re_tests:493] kills a parrot
1961	not ok 495 # TODO [re_tests:495] unknown reason
1962	ok 496 # SKIP [re_tests:496]
1963	not ok 498 # TODO [re_tests:498] unknown reason
1964	not ok 500 # TODO [re_tests:500] unknown reason
1965	not ok 501 # TODO [re_tests:501] unknown reason
1966	ok 502 # SKIP [re_tests:502] unknown reason
1967	not ok 503 # TODO [re_tests:503] unknown reason
1968	not ok 504 # TODO [re_tests:504] unknown reason
1969	not ok 505 # TODO [re_tests:505] unknown reason
1970	not ok 506 # TODO [re_tests:506] unknown reason
1971	not ok 507 # TODO [re_tests:507] unknown reason
1972	not ok 508 # TODO [re_tests:508] unknown reason
1973	not ok 509 # TODO [re_tests:509] unknown reason
1974	not ok 510 # TODO [re_tests:510] unknown reason
1975	not ok 511 # TODO [re_tests:511] unknown reason
1976	not ok 512 # TODO [re_tests:512] unknown reason
1977	not ok 515 # TODO [re_tests:515] unknown reason
1978	not ok 521 # TODO [re_tests:521] unknown reason
1979	not ok 522 # TODO [re_tests:522] unknown reason
1980	not ok 523 # TODO [re_tests:523] unknown reason
1981	not ok 524 # TODO [re_tests:524] unknown reason
1982	not ok 527 # TODO [re_tests:527] unknown reason
1983	not ok 528 # TODO [re_tests:528] unknown reason
1984	ok 531 # SKIP [re_tests:531] bug or error
1985	ok 532 # SKIP [re_tests:532] bug or error
1986	not ok 535 # TODO [re_tests:535] unknown reason
1987	not ok 536 # TODO [re_tests:536] unknown reason
1988	not ok 539 # TODO [re_tests:539] unknown reason
1989	not ok 540 # TODO [re_tests:540] unknown reason
1990	not ok 541 # TODO [re_tests:541] unknown reason
1991	not ok 544 # TODO [re_tests:544] unknown reason
1992	not ok 545 # TODO [re_tests:545] unknown reason
1993	ok 556 # SKIP [re_tests:556] kills a parrot
1994	ok 557 # SKIP [re_tests:557] kills a parrot
1995	not ok 559 # TODO [re_tests:559] unknown reason
1996	ok 563 # SKIP [re_tests:563] bug or error
1997	ok 564 # SKIP [re_tests:564] bug or error
1998	ok 566 # SKIP [re_tests:566] bug or error
1999	ok 568 # SKIP [re_tests:568] kills a parrot
2000	ok 569 # SKIP [re_tests:569] kills a parrot
2001	ok 570 # SKIP [re_tests:570] kills a parrot
2002	ok 571 # SKIP [re_tests:571] kills a parrot
2003	ok 572 # SKIP [re_tests:572] kills a parrot
2004	ok 573 # SKIP [re_tests:573] kills a parrot
2005	ok 574 # SKIP [re_tests:574] kills a parrot
2006	ok 575 # SKIP [re_tests:575] kills a parrot
2007	ok 576 # SKIP [re_tests:576] kills a parrot
2008	ok 577 # SKIP [re_tests:577] kills a parrot
2009	ok 578 # SKIP [re_tests:578] kills a parrot
2010	ok 579 # SKIP [re_tests:579] kills a parrot
2011	ok 580 # SKIP [re_tests:580] kills a parrot
2012	ok 581 # SKIP [re_tests:581] kills a parrot
2013	ok 582 # SKIP [re_tests:582] kills a parrot
2014	ok 583 # SKIP [re_tests:583] kills a parrot
2015	ok 584 # SKIP [re_tests:584] kills a parrot
2016	ok 585 # SKIP [re_tests:585] kills a parrot
2017	ok 586 # SKIP [re_tests:586] kills a parrot
2018	ok 587 # SKIP [re_tests:587] kills a parrot
2019	ok 588 # SKIP [re_tests:588] kills a parrot
2020	ok 589 # SKIP [re_tests:589] kills a parrot
2021	ok 590 # SKIP [re_tests:590] kills a parrot
2022	ok 591 # SKIP [re_tests:591] kills a parrot
2023	ok 592 # SKIP [re_tests:592] kills a parrot
2024	ok 593 # SKIP [re_tests:593] bug or error
2025	ok 594 # SKIP [re_tests:594] bug or error
2026	not ok 595 # TODO [re_tests:595] unknown reason
2027	not ok 596 # TODO [re_tests:596] unknown reason
2028	ok 597 # SKIP [re_tests:597] unknown reason
2029	ok 598 # SKIP [re_tests:598] bug or error
2030	ok 599 # SKIP [re_tests:599] bug or error
2031	not ok 600 # TODO [re_tests:600] unknown reason
2032	not ok 601 # TODO [re_tests:601] unknown reason
2033	not ok 603 # TODO [re_tests:603] unknown reason
2034	not ok 604 # TODO [re_tests:604] unknown reason
2035	not ok 606 # TODO [re_tests:606] unknown reason
2036	not ok 607 # TODO [re_tests:607] unknown reason
2037	ok 609 # SKIP [re_tests:609] unknown reason
2038	ok 610 # SKIP [re_tests:610] unknown reason
2039	ok 611 # SKIP [re_tests:611] unknown reason
2040	ok 612 # SKIP [re_tests:612] unknown reason
2041	ok 613 # SKIP [re_tests:613] unknown reason
2042	ok 614 # SKIP [re_tests:614] unknown reason
2043	ok 615 # SKIP [re_tests:615] unknown reason
2044	ok 616 # SKIP [re_tests:616] unknown reason
2045	ok 617 # SKIP [re_tests:617] unknown reason
2046	not ok 621 # TODO [re_tests:621] unknown reason
2047	not ok 623 # TODO [re_tests:623] unknown reason
2048	not ok 624 # TODO [re_tests:624] unknown reason
2049	not ok 625 # TODO [re_tests:625] unknown reason
2050	ok 627 # SKIP [re_tests:627] unknown reason
2051	ok 628 # SKIP [re_tests:628] unknown reason
2052	ok 629 # SKIP [re_tests:629] unknown reason
2053	ok 630 # SKIP [re_tests:630] unknown reason
2054	ok 631 # SKIP [re_tests:631] unknown reason
2055	ok 632 # SKIP [re_tests:632] unknown reason
2056	ok 633 # SKIP [re_tests:633] unknown reason
2057	ok 634 # SKIP [re_tests:634] unknown reason
2058	ok 635 # SKIP [re_tests:635] unknown reason
2059	not ok 639 # TODO [re_tests:639] unknown reason
2060	not ok 641 # TODO [re_tests:641] unknown reason
2061	not ok 642 # TODO [re_tests:642] unknown reason
2062	not ok 643 # TODO [re_tests:643] unknown reason
2063	ok 645 # SKIP [re_tests:645] unknown reason
2064	ok 646 # SKIP [re_tests:646] unknown reason
2065	ok 647 # SKIP [re_tests:647] unknown reason
2066	ok 648 # SKIP [re_tests:648] unknown reason
2067	ok 649 # SKIP [re_tests:649] unknown reason
2068	ok 650 # SKIP [re_tests:650] unknown reason
2069	ok 651 # SKIP [re_tests:651] unknown reason
2070	ok 652 # SKIP [re_tests:652] unknown reason
2071	ok 653 # SKIP [re_tests:653] unknown reason
2072	ok 663 # SKIP [re_tests:663] unknown reason
2073	ok 664 # SKIP [re_tests:664] unknown reason
2074	ok 665 # SKIP [re_tests:665] unknown reason
2075	ok 666 # SKIP [re_tests:666] unknown reason
2076	ok 667 # SKIP [re_tests:667] unknown reason
2077	ok 668 # SKIP [re_tests:668] unknown reason
2078	ok 669 # SKIP [re_tests:669] unknown reason
2079	ok 670 # SKIP [re_tests:670] unknown reason
2080	ok 671 # SKIP [re_tests:671] unknown reason
2081	ok 681 # SKIP [re_tests:681] unknown reason
2082	ok 682 # SKIP [re_tests:682] unknown reason
2083	ok 683 # SKIP [re_tests:683] unknown reason
2084	ok 684 # SKIP [re_tests:684] unknown reason
2085	ok 685 # SKIP [re_tests:685] unknown reason
2086	ok 686 # SKIP [re_tests:686] unknown reason
2087	ok 687 # SKIP [re_tests:687] unknown reason
2088	ok 688 # SKIP [re_tests:688] unknown reason
2089	ok 689 # SKIP [re_tests:689] unknown reason
2090	not ok 693 # TODO [re_tests:693] unknown reason
2091	not ok 695 # TODO [re_tests:695] unknown reason
2092	not ok 696 # TODO [re_tests:696] unknown reason
2093	not ok 697 # TODO [re_tests:697] unknown reason
2094	ok 699 # SKIP [re_tests:699] unknown reason
2095	ok 700 # SKIP [re_tests:700] unknown reason
2096	ok 701 # SKIP [re_tests:701] unknown reason
2097	ok 702 # SKIP [re_tests:702] unknown reason
2098	ok 703 # SKIP [re_tests:703] unknown reason
2099	ok 704 # SKIP [re_tests:704] unknown reason
2100	ok 705 # SKIP [re_tests:705] unknown reason
2101	ok 706 # SKIP [re_tests:706] unknown reason
2102	ok 707 # SKIP [re_tests:707] unknown reason
2103	ok 717 # SKIP [re_tests:717] unknown reason
2104	ok 718 # SKIP [re_tests:718] unknown reason
2105	ok 719 # SKIP [re_tests:719] unknown reason
2106	ok 720 # SKIP [re_tests:720] unknown reason
2107	ok 721 # SKIP [re_tests:721] unknown reason
2108	ok 722 # SKIP [re_tests:722] unknown reason
2109	ok 723 # SKIP [re_tests:723] unknown reason
2110	ok 724 # SKIP [re_tests:724] unknown reason
2111	ok 725 # SKIP [re_tests:725] unknown reason
2112	ok 735 # SKIP [re_tests:735] unknown reason
2113	ok 736 # SKIP [re_tests:736] unknown reason
2114	ok 737 # SKIP [re_tests:737] unknown reason
2115	ok 738 # SKIP [re_tests:738] unknown reason
2116	ok 739 # SKIP [re_tests:739] unknown reason
2117	ok 740 # SKIP [re_tests:740] unknown reason
2118	ok 741 # SKIP [re_tests:741] unknown reason
2119	ok 742 # SKIP [re_tests:742] unknown reason
2120	ok 743 # SKIP [re_tests:743] unknown reason
2121	not ok 747 # TODO [re_tests:747] unknown reason
2122	not ok 749 # TODO [re_tests:749] unknown reason
2123	not ok 750 # TODO [re_tests:750] unknown reason
2124	not ok 751 # TODO [re_tests:751] unknown reason
2125	ok 753 # SKIP [re_tests:753] unknown reason
2126	ok 754 # SKIP [re_tests:754] unknown reason
2127	ok 755 # SKIP [re_tests:755] unknown reason
2128	ok 756 # SKIP [re_tests:756] unknown reason
2129	ok 757 # SKIP [re_tests:757] unknown reason
2130	ok 758 # SKIP [re_tests:758] unknown reason
2131	ok 759 # SKIP [re_tests:759] unknown reason
2132	ok 760 # SKIP [re_tests:760] unknown reason
2133	ok 761 # SKIP [re_tests:761] unknown reason
2134	ok 771 # SKIP [re_tests:771] unknown reason
2135	ok 772 # SKIP [re_tests:772] unknown reason
2136	ok 773 # SKIP [re_tests:773] unknown reason
2137	ok 774 # SKIP [re_tests:774] unknown reason
2138	ok 775 # SKIP [re_tests:775] unknown reason
2139	ok 776 # SKIP [re_tests:776] unknown reason
2140	ok 777 # SKIP [re_tests:777] unknown reason
2141	ok 778 # SKIP [re_tests:778] unknown reason
2142	ok 779 # SKIP [re_tests:779] unknown reason
2143	ok 789 # SKIP [re_tests:789] unknown reason
2144	ok 790 # SKIP [re_tests:790] unknown reason
2145	ok 791 # SKIP [re_tests:791] unknown reason
2146	ok 792 # SKIP [re_tests:792] unknown reason
2147	ok 793 # SKIP [re_tests:793] unknown reason
2148	ok 794 # SKIP [re_tests:794] unknown reason
2149	ok 795 # SKIP [re_tests:795] unknown reason
2150	ok 796 # SKIP [re_tests:796] unknown reason
2151	ok 797 # SKIP [re_tests:797] unknown reason
2152	ok 800 # SKIP [re_tests:800]
2153	not ok 801 # TODO [re_tests:801] unknown reason
2154	ok 802 # SKIP [re_tests:802]
2155	ok 803 # SKIP [re_tests:803]
2156	ok 805 # SKIP [re_tests:805]
2157	ok 806 # SKIP [re_tests:806] hangs a parrot
2158	ok 807 # SKIP [re_tests:807] hangs a parrot
2159	ok 808 # SKIP [re_tests:808] hangs a parrot
2160	ok 809 # SKIP [re_tests:809] hangs a parrot
2161	ok 810 # SKIP [re_tests:810] hangs a parrot
2162	ok 811 # SKIP [re_tests:811] hangs a parrot
2163	ok 812 # SKIP [re_tests:812] hangs a parrot
2164	ok 813 # SKIP [re_tests:813] hangs a parrot
2165	ok 814 # SKIP [re_tests:814] hangs a parrot
2166	ok 815 # SKIP [re_tests:815] hangs a parrot
2167	ok 816 # SKIP [re_tests:816] hangs a parrot
2168	ok 817 # SKIP [re_tests:817] hangs a parrot
2169	ok 818 # SKIP [re_tests:818] hangs a parrot
2170	ok 819 # SKIP [re_tests:819] hangs a parrot
2171	ok 820 # SKIP [re_tests:820] hangs a parrot
2172	ok 821 # SKIP [re_tests:821] hangs a parrot
2173	ok 822 # SKIP [re_tests:822] hangs a parrot
2174	ok 823 # SKIP [re_tests:823] hangs a parrot
2175	not ok 827 # TODO [re_tests:827] \d in character class
2176	ok 828 # SKIP [re_tests:828]
2177	ok 829 # SKIP [re_tests:829]
2178	ok 830 # SKIP [re_tests:830]
2179	ok 834 # SKIP [re_tests:834]
2180	ok 835 # SKIP [re_tests:835]
2181	ok 836 # SKIP [re_tests:836]
2182	ok 838 # SKIP [re_tests:838]
2183	not ok 858 # TODO [re_tests:858] unknown reason
2184	ok 859 # SKIP [re_tests:859]
2185	ok 862 # SKIP [re_tests:862]
2186	not ok 865 # TODO [re_tests:865] unknown reason
2187	not ok 866 # TODO [re_tests:866] unknown reason
2188	ok 877 # SKIP [re_tests:877]
2189	ok 879 # SKIP [re_tests:879] [ID 20010811.006]
2190	not ok 881 # TODO [re_tests:881] unknown reason
2191	ok 886 # SKIP [re_tests:886]
2192	not ok 887 # TODO [re_tests:887] unknown reason
2193	not ok 888 # TODO [re_tests:888] unknown reason
2194	not ok 890 # TODO [re_tests:890] unknown reason
2195	not ok 891 # TODO [re_tests:891] unknown reason
2196	not ok 893 # TODO [re_tests:893] unknown reason
2197	not ok 896 # TODO [re_tests:896] unknown reason
2198	not ok 897 # TODO [re_tests:897] unknown reason
2199	not ok 898 # TODO [re_tests:898] unknown reason
2200	not ok 899 # TODO [re_tests:899] unknown reason
2201	not ok 901 # TODO [re_tests:901] greediness/lookbehind
2202	not ok 904 # TODO [re_tests:904] greediness/lookbehind
2203	not ok 905 # TODO [re_tests:905] greediness/lookbehind
2204	not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion
2205	not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion
2206	not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion
2207	not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion
2208	not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion
2209	not ok 915 # TODO [re_tests:915] non-greedy/lookbehind
2210	not ok 916 # TODO [re_tests:916] non-greedy/lookbehind
2211	not ok 918 # TODO [re_tests:918] non-greedy/lookbehind
2212	not ok 921 # TODO [re_tests:921] non-greedy/lookbehind
2213	not ok 922 # TODO [re_tests:922] non-greedy/lookbehind
2214	not ok 923 # TODO [re_tests:923] unmatched bracket
2215	ok 924 # SKIP [re_tests:924]
2216	ok 926 # SKIP [re_tests:926] [perl #18019]
2217	not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171]
2218	not ok 928 # TODO [re_tests:928] reuse captured group
2219	not ok 929 # TODO [re_tests:929] reuse captured group
2220	not ok 930 # TODO [re_tests:930] reuse captured group
2221	not ok 931 # TODO [re_tests:931] reuse captured group
2222	not ok 932 # TODO [re_tests:932] reuse captured group
2223	not ok 933 # TODO [re_tests:933] reuse captured group
2224	not ok 934 # TODO [re_tests:934] reuse captured group
2225	not ok 935 # TODO [re_tests:935] reuse captured group
2226	not ok 936 # TODO [re_tests:936] reuse captured group
2227	not ok 937 # TODO [re_tests:937] reuse captured group
2228	not ok 938 # TODO [re_tests:938] reuse captured group
2229	not ok 939 # TODO [re_tests:939] reuse captured group
2230	not ok 940 # TODO [re_tests:940] reuse captured group
2231	not ok 941 # TODO [re_tests:941] reuse captured group
2232	not ok 942 # TODO [re_tests:942] reuse captured group
2233	ok 944 # SKIP [re_tests:944] unknown reason
2234	ok 945 # SKIP [re_tests:945] unknown reason
2235	ok 957 # SKIP [re_tests:957]
2236	ok 958 # SKIP [re_tests:958]
2237	not ok 959 # TODO [re_tests:959] [perl #34195]
2238	not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion
2239	ok
2240	t/compilers/pge/perl6regex/01-regex....
2241	not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&\|) - parse error
2242	not ok 99 # TODO [rx_metachars:114] null pattern invalid
2243	not ok 386 # TODO [rx_backtrack:4] basic
2244	not ok 427 # TODO [rx_charclass:26] illegal character range
2245	not ok 458 # TODO [rx_charclass:62] literal match (\")
2246	not ok 459 # TODO [rx_charclass:64] literal match (\")
2247	not ok 460 # TODO [rx_charclass:66] literal match with quote
2248	not ok 461 # TODO [rx_charclass:68] literal match with quote
2249	not ok 462 # TODO [rx_charclass:70] literal match with backslash
2250	not ok 463 # TODO [rx_charclass:72] literal match with interpolation
2251	not ok 464 # TODO [rx_charclass:74] literal match with interpolation
2252	not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i)
2253	not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s)
2254	not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s)
2255	not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s)
2256	not ok 709 # TODO [rx_modifiers:131] basic ws match
2257	not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5)
2258	not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth)
2259	not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth)
2260	ok
2261	t/compilers/pge/perl6regex/context.....
2262	not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented
2263	ok
2264	t/compilers/tge/basic..................ok
2265	t/compilers/tge/grammar................
2266	not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug
2267	ok
2268	t/compilers/tge/parser.................ok
2269	t/library/cgi_query_hash...............ok
2270	t/library/coroutine....................ok
2271	t/library/dumper.......................ok
2272	t/library/getopt_obj...................ok
2273	t/library/hllmacros....................ok
2274	t/library/iter.........................ok
2275	t/library/md5..........................ok
2276	t/library/mime_base64..................ok
2277	t/library/mt19937ar....................ok
2278	t/library/p6object.....................
2279	not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) >
2280	ok
2281	t/library/parrotlib....................ok
2282	t/library/pcre.........................
2283	ok 1 # SKIP no pcre-config
2284	ok
2285	t/library/pg...........................
2286	ok 1 # SKIP skipped
2287	ok 2 # SKIP skipped
2288	ok 3 # SKIP skipped
2289	ok 4 # SKIP skipped
2290	ok 5 # SKIP skipped
2291	ok 6 # SKIP skipped
2292	ok 7 # SKIP skipped
2293	ok 8 # SKIP skipped
2294	ok 9 # SKIP skipped
2295	ok 10 # SKIP skipped
2296	ok 11 # SKIP skipped
2297	ok 12 # SKIP skipped
2298	ok 13 # SKIP skipped
2299	ok 14 # SKIP skipped
2300	ok 15 # SKIP skipped
2301	ok 16 # SKIP skipped
2302	ok 17 # SKIP skipped
2303	ok 18 # SKIP skipped
2304	ok 19 # SKIP skipped
2305	ok 20 # SKIP skipped
2306	ok 21 # SKIP skipped
2307	ok 22 # SKIP skipped
2308	ok 23 # SKIP skipped
2309	ok 24 # SKIP skipped
2310	ok 25 # SKIP skipped
2311	ok 26 # SKIP skipped
2312	ok 27 # SKIP skipped
2313	ok 28 # SKIP skipped
2314	ok 29 # SKIP skipped
2315	ok 30 # SKIP skipped
2316	ok 31 # SKIP skipped
2317	ok 32 # SKIP skipped
2318	ok 33 # SKIP skipped
2319	ok 34 # SKIP skipped
2320	ok 35 # SKIP skipped
2321	ok 36 # SKIP skipped
2322	ok 37 # SKIP skipped
2323	ok 38 # SKIP skipped
2324	ok 39 # SKIP skipped
2325	ok 40 # SKIP skipped
2326	ok 41 # SKIP skipped
2327	ok 42 # SKIP skipped
2328	ok 43 # SKIP skipped
2329	ok
2330	t/library/protoobject..................ok
2331	t/library/rand.........................ok
2332	t/library/range........................ok
2333	t/library/streams......................
2334	ok 18 # SKIP broken method invocation
2335	ok 20 # SKIP broken method invocation
2336	ok
2337	t/library/string_utils.................ok
2338	t/library/tcl_glob.....................ok
2339	t/library/tcl_lib......................ok
2340	t/library/test_builder_tester..........ok
2341	t/library/test_class...................ok
2342	t/library/test_more....................ok
2343	t/library/uuid.........................ok
2344	t/library/yaml_dumper..................
2345	not ok 7 - properties # TODO not yet implemented
2346	not ok 8 - indent string # TODO not supported
2347	not ok 9 - back-referencing properties # TODO not yet implemented
2348	not ok 10 - self-referential properties (1) # TODO not yet implemented
2349	not ok 11 - self-referential properties (2) # TODO not yet implemented
2350	not ok 26 - custom dumper # TODO not yet implemented
2351	ok
2352	t/library/yaml_parser_syck.............
2353	not ok 1 - basic parsing # TODO Not properly implemented yet
2354	ok
2355	All tests successful.
2356
2357	Test Summary Report
2358	-------------------
2359	t/pmc/exception (Wstat: 0 Tests: 31 Failed: 0)
2360	TODO passed: 30
2361	Files=252, Tests=8326, 459 wallclock secs ( 6.10 usr 4.04 sys + 188.72 cusr 114.40 csys = 313.26 CPU)
2362	Result: PASS
2363	perl t/harness --gc-debug --running-make-test -f --runcore-tests
2364	t/compilers/imcc/imcpasm/cfg...........ok
2365	t/compilers/imcc/imcpasm/opt0..........
2366	ok 1 # SKIP disabled graph coloring register allocator, RT #57028
2367	ok 3 # SKIP disabled graph coloring register allocator, RT #57028
2368	ok
2369	t/compilers/imcc/imcpasm/opt1..........
2370	ok 76 # SKIP constant concat N/Y
2371	ok
2372	t/compilers/imcc/imcpasm/opt2..........
2373	ok 5 # SKIP loop opt disabled for now
2374	ok
2375	t/compilers/imcc/imcpasm/optc..........
2376	not ok 9 - tailcall 1 # TODO RT #57028
2377	ok
2378	t/compilers/imcc/imcpasm/pcc...........ok
2379	t/compilers/imcc/imcpasm/sub...........ok
2380	t/compilers/imcc/reg/alloc.............ok
2381	t/compilers/imcc/reg/spill.............ok
2382	t/compilers/imcc/syn/bsr...............ok
2383	t/compilers/imcc/syn/clash.............
2384	not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet
2385	ok
2386	t/compilers/imcc/syn/const.............ok
2387	t/compilers/imcc/syn/errors............ok
2388	t/compilers/imcc/syn/eval..............
2389	ok 1 # SKIP changed eval semantics - see t/pmc/eval.t
2390	ok 2 # SKIP changed eval semantics - see t/pmc/eval.t
2391	ok 3 # SKIP changed eval semantics - see t/pmc/eval.t
2392	ok 4 # SKIP changed eval semantics - see t/pmc/eval.t
2393	ok 5 # SKIP changed eval semantics - see t/pmc/eval.t
2394	ok 6 # SKIP changed eval semantics - see t/pmc/eval.t
2395	ok 7 # SKIP changed eval semantics - see t/pmc/eval.t
2396	ok
2397	t/compilers/imcc/syn/file..............
2398	ok 13 # SKIP multiple loading not speced - failing
2399	ok
2400	t/compilers/imcc/syn/hll...............ok
2401	t/compilers/imcc/syn/keyed.............
2402	ok 1 # SKIP experimental
2403	ok
2404	t/compilers/imcc/syn/labels............ok
2405	t/compilers/imcc/syn/macro.............
2406	not ok 25 - unterminated macro 2 # TODO Darwin segfault -- RT #60926
2407	ok
2408	t/compilers/imcc/syn/objects...........ok
2409	t/compilers/imcc/syn/op................ok
2410	t/compilers/imcc/syn/pasm..............ok
2411	t/compilers/imcc/syn/pcc...............ok
2412	t/compilers/imcc/syn/pod...............
2413	ok 4 # SKIP Closing out of pod from included files
2414	ok
2415	t/compilers/imcc/syn/regressions.......
2416	not ok 4 - comments between .param(RT \#46499) # TODO broken
2417	not ok 6 - whitespace between .param(RT \#46499) # TODO broken
2418	not ok 7 - off by one error message (RT \#40204) # TODO broken
2419	ok
2420	t/compilers/imcc/syn/scope.............ok
2421	t/compilers/imcc/syn/subflags..........
2422	not ok 15 # TODO :method sub not found in namespace
2423	ok
2424	t/compilers/imcc/syn/symbols...........ok
2425	t/compilers/imcc/syn/tail..............ok
2426	t/compilers/imcc/syn/veracity..........ok
2427	t/op/00ff-dos..........................ok
2428	t/op/00ff-unix.........................ok
2429	t/op/01-parse_ops......................ok
2430	t/op/64bit.............................
2431	1..0 # Skip 64bit INTVAL platforms only
2432	skipped: 64bit INTVAL platforms only
2433	t/op/annotate..........................ok
2434	t/op/arithmetics.......................
2435	ok 28 # SKIP No integer overflow for 32-bit INTVALs without GMP installed
2436	ok
2437	t/op/basic.............................ok
2438	t/op/bitwise...........................
2439	ok 27 # SKIP no BigInt lib found
2440	ok
2441	t/op/box...............................ok
2442	t/op/calling...........................
2443	not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all
2444	not ok 93 - arg mismatch with no params # TODO RT #39844
2445	ok
2446	t/op/cc_params.........................ok
2447	t/op/cc_state..........................
2448	not ok 6 - positional found, named expected # TODO cc processor state missing
2449	not ok 8 - G2: argument underflow: required slurpy param # TODO failing
2450	ok
2451	t/op/cmp-nonbranch.....................ok
2452	t/op/comp..............................ok
2453	t/op/copy..............................ok
2454	t/op/debuginfo.........................
2455	ok 1 # SKIP disabled on fast-core
2456	ok 7 # SKIP disabled on this core
2457	ok 8 # SKIP disabled on this core
2458	ok
2459	t/op/exceptions........................
2460	not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans
2461	ok
2462	t/op/gc................................ok
2463	t/op/globals...........................ok
2464	t/op/hacks.............................
2465	ok 1 # SKIP no universal SIGFPE handling
2466	ok 2 # SKIP no universal SIGFPE handling
2467	ok
2468	t/op/ifunless..........................ok
2469	t/op/integer...........................ok
2470	t/op/interp............................
2471	ok 1 # SKIP we really shouldn't run just a label - use a sub
2472	ok
2473	t/op/io................................ok
2474	t/op/jit...............................ok
2475	t/op/jitn..............................ok
2476	t/op/lexicals..........................
2477	not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented
2478	ok
2479	t/op/literal...........................ok
2480	t/op/load_bytecode.....................ok
2481	t/op/number............................ok
2482	t/op/pushaction........................
2483	not ok 7 - pushaction: error while handling error # TODO runloop shenanigans
2484	ok
2485	t/op/say...............................ok
2486	t/op/spawnw............................ok
2487	t/op/sprintf...........................
2488	ok 5 # SKIP parrot extension (%B)
2489	ok 7 # SKIP perl5-specific extension (%D)
2490	ok 9 # SKIP perl5-specific extension (%F)
2491	ok 16 # SKIP parrot extension (%H)
2492	ok 20 # SKIP parrot extension (%L)
2493	ok 23 # SKIP perl5-specific extension (%O)
2494	ok 24 # SKIP parrot extension (%P)
2495	ok 27 # SKIP parrot extension (%S)
2496	ok 29 # SKIP perl5-specific extension (%U)
2497	not ok 64 # TODO [%03.2d] actual: > 01<
2498	ok 71 # SKIP perl5-specific extension (%v...)
2499	ok 72 # SKIP perl5-specific extension (%v...)
2500	ok 73 # SKIP perl5-specific extension (%v...)
2501	ok 74 # SKIP perl5-specific extension (%v...)
2502	ok 75 # SKIP perl5-specific extension (%v...)
2503	ok 76 # SKIP perl5-specific extension (%v...)
2504	ok 77 # SKIP perl5-specific extension (%v...)
2505	ok 78 # SKIP perl5-specific extension (%v...)
2506	ok 79 # SKIP perl5-specific extension (%v...)
2507	ok 80 # SKIP perl5-specific extension (%v...)
2508	ok 81 # SKIP perl5-specific extension (%v...)
2509	ok 82 # SKIP perl5-specific extension (%v...)
2510	ok 83 # SKIP perl5-specific extension (%v...)
2511	ok 84 # SKIP perl5-specific extension (%v...)
2512	ok 85 # SKIP perl5-specific extension (%v...)
2513	ok 86 # SKIP perl5-specific extension (%v...)
2514	ok 87 # SKIP perl5-specific extension (%v...)
2515	ok 88 # SKIP perl5-specific extension (%v...)
2516	ok 89 # SKIP perl5-specific extension (%v...)
2517	ok 90 # SKIP perl5-specific extension (%v...)
2518	ok 91 # SKIP perl5-specific extension (%v...)
2519	ok 92 # SKIP perl5-specific extension (%v...)
2520	ok 93 # SKIP perl5-specific extension (%v...)
2521	ok 94 # SKIP perl5-specific extension (%v...)
2522	ok 95 # SKIP perl5-specific extension (%v...)
2523	ok 96 # SKIP perl5-specific extension (%v...)
2524	ok 97 # SKIP perl5-specific extension (%v...)
2525	ok 98 # SKIP perl5-specific extension (%v...)
2526	ok 99 # SKIP perl5-specific extension (%v...)
2527	ok 114 # SKIP harness needs support for * modifier
2528	ok 131 # SKIP harness needs support for * modifier
2529	ok 141 # SKIP harness needs support for * modifier
2530	ok 144 # SKIP perl5 expresssion as test value
2531	not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1<
2532	ok 161 # SKIP harness needs support for * modifier
2533	ok 166 # SKIP harness needs support for * modifier
2534	not ok 187 # TODO [%h] actual: ><
2535	not ok 191 # TODO [%l] actual: ><
2536	ok 193 # SKIP perl5-specific test
2537	ok 200 # SKIP perl5-specific test
2538	ok 201 # SKIP perl5-specific test
2539	ok 202 # SKIP parrot extension (%p)
2540	ok 204 # SKIP parrot extension (%r)
2541	ok 210 # SKIP harness needs support for * modifier
2542	ok 214 # SKIP harness needs support for * modifier
2543	not ok 223 # TODO [%v] actual: ><
2544	ok 233 # SKIP harness needs support for * modifier
2545	ok 234 # SKIP perl5-specific extension (%v...)
2546	ok 235 # SKIP perl5-specific extension (%v...)
2547	ok 238 # SKIP perl5-specific test
2548	ok 239 # SKIP perl5-specific test
2549	ok 240 # SKIP perl5-specific test
2550	ok 241 # SKIP perl5-specific test
2551	ok 242 # SKIP perl5-specific test
2552	ok 243 # SKIP perl5-specific test
2553	ok 244 # SKIP perl5-specific test
2554	ok 245 # SKIP perl5-specific test
2555	ok 246 # SKIP perl5-specific test
2556	ok 247 # SKIP perl5-specific test
2557	ok 248 # SKIP perl5-specific test
2558	ok 249 # SKIP perl5-specific test
2559	ok 250 # SKIP perl5-specific test
2560	ok 251 # SKIP perl5-specific test
2561	ok 252 # SKIP perl5-specific extension (%v...)
2562	ok 253 # SKIP perl5-specific extension (%v...)
2563	ok 254 # SKIP perl5-specific extension (%v...)
2564	ok 255 # SKIP perl5-specific extension (%v...)
2565	ok 256 # SKIP perl5-specific extension (%v...)
2566	ok 257 # SKIP perl5-specific extension (%v...)
2567	ok 258 # SKIP perl5-specific extension (%v...)
2568	ok 259 # SKIP perl5-specific extension (%v...)
2569	ok 260 # SKIP perl5-specific extension (%v...)
2570	ok 261 # SKIP perl5-specific extension (%v...)
2571	ok 262 # SKIP perl5-specific extension (%v...)
2572	ok 263 # SKIP perl5-specific extension (%v...)
2573	ok 264 # SKIP perl5-specific extension (%v...)
2574	ok 265 # SKIP perl5-specific extension (%v...)
2575	ok 266 # SKIP perl5-specific extension (%v...)
2576	ok 267 # SKIP perl5-specific extension (%v...)
2577	ok 268 # SKIP perl5-specific extension (%v...)
2578	ok 269 # SKIP perl5-specific extension (%v...)
2579	ok 270 # SKIP perl5-specific extension (%v...)
2580	ok 271 # SKIP perl5-specific extension (%v...)
2581	ok 272 # SKIP perl5-specific extension (%v...)
2582	ok 273 # SKIP perl5-specific extension (%v...)
2583	ok 274 # SKIP perl5-specific extension (%v...)
2584	ok 275 # SKIP perl5-specific extension (%v...)
2585	ok 276 # SKIP perl5-specific extension (%v...)
2586	ok 277 # SKIP perl5-specific extension (%v...)
2587	ok 278 # SKIP perl5-specific extension (%v...)
2588	ok 279 # SKIP perl5-specific extension (%v...)
2589	ok 280 # SKIP perl5-specific extension (%v...)
2590	ok 281 # SKIP perl5-specific extension (%v...)
2591	ok 282 # SKIP perl5-specific extension (%v...)
2592	ok 283 # SKIP perl5-specific extension (%v...)
2593	ok 284 # SKIP perl5-specific extension (%v...)
2594	ok 285 # SKIP perl5-specific extension (%v...)
2595	ok 286 # SKIP perl5-specific extension (%v...)
2596	ok 287 # SKIP perl5-specific extension (%v...)
2597	ok 288 # SKIP perl5-specific extension (%v...)
2598	ok 289 # SKIP perl5-specific extension (%v...)
2599	ok 290 # SKIP perl5-specific extension (%v...)
2600	ok 291 # SKIP perl5-specific extension (%v...)
2601	ok 292 # SKIP perl5-specific extension (%v...)
2602	ok 293 # SKIP perl5-specific extension (%v...)
2603	ok 294 # SKIP perl5-specific extension (%v...)
2604	ok 295 # SKIP perl5-specific extension (%v...)
2605	ok 296 # SKIP perl5-specific extension (%v...)
2606	ok 297 # SKIP perl5-specific extension (%v...)
2607	ok 298 # SKIP perl5-specific extension (%v...)
2608	ok 300 # SKIP harness needs support for * modifier
2609	not ok 304 # TODO [%#b] actual: >0b0<
2610	not ok 305 # TODO [%#o] actual: >00<
2611	not ok 306 # TODO [%#x] actual: >0x0<
2612	ok 307 # SKIP perl5-specific extension (%v...)
2613	ok 308 # SKIP perl5-specific extension (%v...)
2614	ok
2615	t/op/sprintf2..........................ok
2616	t/op/string............................
2617	ok 103 # SKIP Pending rework of creating non-ascii literals
2618	ok 104 # SKIP Pending rework of creating non-ascii literals
2619	ok 118 # SKIP Pending reimplementation of find_encoding
2620	ok 119 # SKIP no more visible encoding
2621	ok 137 # SKIP No unicode yet
2622	ok 139 # SKIP no more transcode
2623	ok 140 # SKIP no more chartype
2624	ok
2625	t/op/string_cclass.....................
2626	ok 7 # SKIP unicode support unavailable
2627	ok 8 # SKIP unicode support unavailable
2628	ok 9 # SKIP unicode support unavailable
2629	ok
2630	t/op/string_cs.........................
2631	ok 31 # SKIP no ICU lib
2632	ok 32 # SKIP no ICU lib
2633	ok 33 # SKIP no ICU lib
2634	ok 34 # SKIP no ICU lib
2635	ok 35 # SKIP no ICU lib
2636	ok 36 # SKIP no ICU lib
2637	ok 37 # SKIP no ICU lib
2638	ok 38 # SKIP no ICU lib
2639	ok 39 # SKIP no ICU lib
2640	ok 40 # SKIP no ICU lib
2641	ok 41 # SKIP no ICU lib
2642	ok 42 # SKIP no ICU lib
2643	ok 43 # SKIP no ICU lib
2644	ok 44 # SKIP no ICU lib
2645	ok 45 # SKIP no ICU lib
2646	ok 46 # SKIP no ICU lib
2647	ok
2648	t/op/string_mem........................ok
2649	t/op/stringu...........................
2650	ok 20 # SKIP no ICU lib
2651	ok 21 # SKIP no ICU lib
2652	ok 22 # SKIP no ICU lib
2653	ok 25 # SKIP Tests seem to fail on big endian machines with icu
2654	ok 26 # SKIP Tests seem to fail on big endian machines with icu
2655	not ok 27 - UTF-8 and Unicode literals # TODO TT #24
2656	ok
2657	t/op/sysinfo...........................
2658	not ok 11 - sysinfo OS version string # TODO Not Currently Implemented
2659	not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented
2660	ok 13 # SKIP Requires a lot of work to find out the correct answer
2661	ok 14 # SKIP Testing only in some known platforms
2662	ok
2663	t/op/time..............................ok
2664	t/op/trans.............................ok
2665	t/pmc/addrregistry.....................ok
2666	t/pmc/array............................
2667	not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken
2668	ok
2669	t/pmc/bigint...........................
2670	1..0 # Skip No BigInt Lib configured
2671	skipped: No BigInt Lib configured
2672	t/pmc/bignum...........................
2673	1..0 # Skip No BigNum PMC enabled
2674	skipped: No BigNum PMC enabled
2675	t/pmc/boolean..........................ok
2676	t/pmc/bound_nci........................ok
2677	t/pmc/callsignature....................ok
2678	t/pmc/capture..........................ok
2679	t/pmc/class............................
2680	not ok 28 # TODO add_method() invoking method added to class works
2681	ok
2682	t/pmc/codestring.......................ok
2683	t/pmc/complex..........................
2684	ok 58 # SKIP div by zero not caught
2685	ok 59 # SKIP div by zero not caught
2686	ok 60 # SKIP div by zero not caught
2687	ok 86 # SKIP instantiate n/y
2688	ok 87 # SKIP instantiate n/y
2689	ok 88 # SKIP instantiate n/y
2690	ok 89 # SKIP instantiate n/y
2691	ok 126 # SKIP inf is not platform-independent
2692	ok 465 # SKIP add using subclass of Complex - RT #59630
2693	ok 466 # SKIP add using subclass of Complex - RT #59630
2694	ok 467 # SKIP add using subclass of Complex - RT #59630
2695	ok
2696	t/pmc/config...........................ok
2697	t/pmc/continuation.....................ok
2698	t/pmc/coroutine........................
2699	not ok 9 - Call an exited coroutine # TODO goes one iteration too far.
2700	ok
2701	t/pmc/cpointer.........................ok
2702	t/pmc/default..........................
2703	not ok 1 - new # TODO not implemeted
2704	ok
2705	t/pmc/env..............................ok
2706	t/pmc/eval.............................ok
2707	t/pmc/eventhandler.....................ok
2708	t/pmc/exception........................
2709	not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans
2710	not ok 25 - pushaction: error while handling error # TODO runloop shenanigans
2711	not ok 27 - invoke handler in calling sub # TODO deprecate rethrow
2712	not ok 30 - catch ex from C-level MULTI function # TODO broken
2713	ok
2714	t/pmc/exceptionhandler.................ok
2715	t/pmc/exporter.........................ok
2716	t/pmc/file.............................ok
2717	t/pmc/filehandle.......................
2718	ok 3 # SKIP no asynch calls yet
2719	not ok 8 - record_separator # TODO not yet implemented
2720	ok
2721	t/pmc/fixedbooleanarray................ok
2722	t/pmc/fixedfloatarray..................ok
2723	t/pmc/fixedintegerarray................ok
2724	t/pmc/fixedpmcarray....................ok
2725	t/pmc/fixedstringarray.................ok
2726	t/pmc/float............................ok
2727	t/pmc/freeze...........................ok
2728	t/pmc/globals..........................ok
2729	t/pmc/hash.............................ok
2730	t/pmc/integer..........................ok
2731	t/pmc/io...............................
2732	not ok 1 - IO on some invalid types # TODO IO on some invalid types
2733	ok 8 # SKIP clone not finished yet
2734	not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433
2735	not ok 40 - string read/write handle # TODO no stringhandle yet
2736	ok
2737	t/pmc/io_iterator......................
2738	not ok 1 - new # TODO not yet implemented
2739	not ok 2 - shift # TODO not yet implemented
2740	not ok 3 - get_bool (vtable) # TODO not yet implemented
2741	ok
2742	t/pmc/io_status........................
2743	not ok 1 - new # TODO not yet implemented
2744	not ok 2 - get_integer (vtable) # TODO not yet implemented
2745	not ok 3 - get_bool (vtable) # TODO not yet implemented
2746	not ok 4 - return # TODO not yet implemented
2747	not ok 5 - error # TODO not yet implemented
2748	not ok 6 - throw # TODO not yet implemented
2749	ok
2750	t/pmc/iterator.........................
2751	ok 13 # SKIP N/Y: length of rest of array
2752	not ok 16 - adding keys during iteration # TODO adding keys during iteration
2753	not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points'
2754	ok
2755	t/pmc/key..............................
2756	not ok 10 # TODO register and non-register string keys should be COW (RT #60128)
2757	ok
2758	t/pmc/lexinfo..........................ok
2759	t/pmc/lexpad...........................ok
2760	t/pmc/managedstruct....................ok
2761	t/pmc/multidispatch....................
2762	not ok 22 - MMD on PMC types - Any # TODO RT #41374
2763	not ok 25 - add as method - inherited # TODO RT #41374
2764	not ok 32 - use a core func for an object # TODO RT #59628
2765	ok
2766	t/pmc/multisub.........................ok
2767	t/pmc/namespace........................
2768	not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17
2769	ok
2770	t/pmc/nci..............................ok
2771	t/pmc/null.............................ok
2772	t/pmc/object-meths.....................
2773	ok 14 # SKIP currently broken
2774	ok 25 # SKIP no bound NCI method
2775	ok
2776	t/pmc/object-mro.......................ok
2777	t/pmc/object...........................ok
2778	t/pmc/objects..........................ok
2779	t/pmc/orderedhash......................ok
2780	t/pmc/os...............................ok
2781	t/pmc/packfile.........................ok
2782	t/pmc/packfileconstanttable............
2783	not ok 3 - get_type, get_*_keyed_int # TODO See TT #385.
2784	ok
2785	t/pmc/packfiledirectory................ok
2786	t/pmc/packfilefixupentry...............ok
2787	t/pmc/packfilefixuptable...............ok
2788	t/pmc/packfilerawsegment...............ok
2789	t/pmc/packfilesegment..................ok
2790	t/pmc/parrotclass......................ok
2791	t/pmc/parrotinterpreter................ok
2792	t/pmc/parrotio.........................
2793	not ok 2 - open and close - synchronous # TODO not yet implemented
2794	ok 3 # SKIP no asynch calls yet
2795	not ok 4 - print, read, and readline - synchronous # TODO not yet implemented
2796	not ok 5 - record_separator # TODO not yet implemented
2797	not ok 6 - buffer_type # TODO not yet implemented
2798	ok
2799	t/pmc/parrotlibrary....................ok
2800	t/pmc/parrotobject.....................ok
2801	t/pmc/parrotrunningthread..............ok
2802	t/pmc/parrotthread.....................ok
2803	t/pmc/pccmethod_test...................ok
2804	t/pmc/pmc..............................ok
2805	t/pmc/pmcproxy.........................ok
2806	t/pmc/pointer..........................ok
2807	t/pmc/prop.............................ok
2808	t/pmc/random...........................ok
2809	t/pmc/ref..............................ok
2810	t/pmc/resizablebooleanarray............ok
2811	t/pmc/resizablefloatarray..............ok
2812	t/pmc/resizableintegerarray............ok
2813	t/pmc/resizablepmcarray................ok
2814	t/pmc/resizablestringarray.............ok
2815	t/pmc/retcontinuation..................ok
2816	t/pmc/ro...............................
2817	not ok 8 - ResizablePMCArray -- Recursive # TODO 1
2818	ok
2819	t/pmc/role.............................ok
2820	t/pmc/scalar...........................
2821	ok 1 # SKIP doesn't work yet
2822	ok
2823	t/pmc/scheduler........................ok
2824	t/pmc/schedulermessage.................ok
2825	t/pmc/sharedref........................ok
2826	t/pmc/signal...........................
2827	1..0 # Skip Signals currently disabled
2828	skipped: Signals currently disabled
2829	t/pmc/slice............................
2830	not ok 2 - bug with slice bits # TODO parser
2831	ok
2832	t/pmc/string...........................ok
2833	t/pmc/stringhandle.....................
2834	ok 3 # SKIP no asynch calls yet
2835	not ok 9 - record_separator # TODO not yet implemented
2836	ok
2837	t/pmc/sub..............................ok
2838	t/pmc/sys..............................ok
2839	t/pmc/task.............................ok
2840	t/pmc/threads..........................
2841	not ok 11 - CLONE_CODE \| CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511
2842	not ok 15 - CLONE_CODE\|CLONE_GLOBALS\|CLONE_HLL\|CLONE_LIBRARIES # TODO RT #41373
2843	ok
2844	t/pmc/timer............................ok
2845	t/pmc/undef............................ok
2846	t/pmc/unmanagedstruct..................ok
2847	t/oo/attributes........................ok
2848	t/oo/composition.......................ok
2849	t/oo/inheritance.......................ok
2850	t/oo/isa...............................ok
2851	t/oo/metamodel.........................
2852	not ok 6 # TODO tail attribute has a type
2853	not ok 12 # TODO new opcode makes working objects
2854	ok
2855	t/oo/methods...........................ok
2856	t/oo/mro-c3............................ok
2857	t/oo/names.............................ok
2858	t/oo/new...............................ok
2859	t/oo/ops...............................ok
2860	t/oo/proxy.............................ok
2861	t/oo/subclass..........................ok
2862	t/oo/vtableoverride....................ok
2863	t/native_pbc/header....................
2864	1..0 # Skip pending robust testing strategy, TT #357
2865	skipped: pending robust testing strategy, TT #357
2866	t/native_pbc/integer...................
2867	1..0 # Skip pending robust testing strategy, TT #357
2868	skipped: pending robust testing strategy, TT #357
2869	t/native_pbc/number....................
2870	1..0 # Skip pending robust testing strategy, TT #357
2871	skipped: pending robust testing strategy, TT #357
2872	t/native_pbc/string....................
2873	1..0 # Skip pending robust testing strategy, TT #357
2874	skipped: pending robust testing strategy, TT #357
2875	t/dynpmc/dynlexpad.....................
2876	not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads
2877	ok
2878	t/dynpmc/foo...........................
2879	ok 6 # SKIP No BigInt Lib configured
2880	ok
2881	t/dynpmc/gdbmhash......................
2882	1..0 # Skip No gdbm library available
2883	skipped: No gdbm library available
2884	t/dynpmc/md2...........................ok
2885	t/dynpmc/md4...........................ok
2886	t/dynpmc/md5...........................ok
2887	t/dynpmc/pair..........................ok
2888	t/dynpmc/rational......................ok
2889	t/dynpmc/ripemd160.....................ok
2890	t/dynpmc/rotest........................ok
2891	t/dynpmc/sha...........................ok
2892	t/dynpmc/sha1..........................ok
2893	t/dynpmc/sha256........................
2894	1..0 # Skip Too old library
2895	skipped: Too old library
2896	t/dynpmc/sha512........................
2897	1..0 # Skip Too old library
2898	skipped: Too old library
2899	t/dynpmc/subclass_with_pir_method......
2900	not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces
2901	not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces
2902	ok
2903	t/dynpmc/subproxy......................ok
2904	t/dynoplibs/dan........................ok
2905	t/dynoplibs/myops......................ok
2906	t/compilers/pct/complete_workflow......ok
2907	t/compilers/pct/past...................ok
2908	t/compilers/pct/pct_hllcompiler........ok
2909	t/compilers/pct/post...................ok
2910	t/compilers/pge/00-basic...............ok
2911	t/compilers/pge/02-match...............ok
2912	t/compilers/pge/03-optable.............ok
2913	t/compilers/pge/04-compile.............ok
2914	t/compilers/pge/06-grammar.............ok
2915	t/compilers/pge/pge-hs.................ok
2916	t/compilers/pge/pge....................ok
2917	t/compilers/pge/pge_examples...........ok
2918	t/compilers/pge/pge_globs..............ok
2919	t/compilers/pge/pge_text...............ok
2920	t/compilers/pge/pge_util...............ok
2921	t/compilers/pge/p5regex/p5rx...........
2922	not ok 116 # TODO [re_tests:116] character class in enumeration
2923	not ok 119 # TODO [re_tests:119] character class in enumeration
2924	not ok 120 # TODO [re_tests:120] character class in enumeration
2925	not ok 123 # TODO [re_tests:123] character class in enumeration
2926	not ok 124 # TODO [re_tests:124] character class in enumeration
2927	not ok 127 # TODO [re_tests:127] character class in enumeration
2928	ok 138 # SKIP [re_tests:138] parser bug
2929	ok 139 # SKIP [re_tests:139] broken col 4?
2930	ok 143 # SKIP [re_tests:143] bug or error
2931	ok 144 # SKIP [re_tests:144] bug or error
2932	ok 148 # SKIP [re_tests:148] bug or error
2933	ok 149 # SKIP [re_tests:149] bug or error
2934	ok 155 # SKIP [re_tests:155] bug or error
2935	ok 167 # SKIP [re_tests:167] bug or error
2936	not ok 234 # TODO [re_tests:234] unknown reason
2937	not ok 235 # TODO [re_tests:235] unknown reason
2938	not ok 236 # TODO [re_tests:236] unknown reason
2939	not ok 246 # TODO [re_tests:246] unknown reason
2940	not ok 247 # TODO [re_tests:247] unknown reason
2941	ok 248 # SKIP [re_tests:248] bug or error
2942	ok 249 # SKIP [re_tests:249] bug or error
2943	ok 252 # SKIP [re_tests:252] bug or error
2944	not ok 254 # TODO [re_tests:254] unknown reason
2945	not ok 256 # TODO [re_tests:256] unknown reason
2946	not ok 257 # TODO [re_tests:257] unknown reason
2947	ok 264 # SKIP [re_tests:264] trailing modifiers
2948	ok 265 # SKIP [re_tests:265] trailing modifiers
2949	ok 266 # SKIP [re_tests:266] trailing modifiers
2950	ok 267 # SKIP [re_tests:267] trailing modifiers
2951	ok 268 # SKIP [re_tests:268] trailing modifiers
2952	ok 269 # SKIP [re_tests:269] trailing modifiers
2953	ok 270 # SKIP [re_tests:270] trailing modifiers
2954	ok 271 # SKIP [re_tests:271] trailing modifiers
2955	ok 272 # SKIP [re_tests:272] trailing modifiers
2956	ok 273 # SKIP [re_tests:273] trailing modifiers
2957	ok 274 # SKIP [re_tests:274] trailing modifiers
2958	ok 275 # SKIP [re_tests:275] trailing modifiers
2959	ok 276 # SKIP [re_tests:276] trailing modifiers
2960	ok 277 # SKIP [re_tests:277] trailing modifiers
2961	ok 278 # SKIP [re_tests:278] trailing modifiers
2962	ok 279 # SKIP [re_tests:279] trailing modifiers
2963	ok 280 # SKIP [re_tests:280] trailing modifiers
2964	ok 281 # SKIP [re_tests:281] trailing modifiers
2965	ok 282 # SKIP [re_tests:282] trailing modifiers
2966	ok 283 # SKIP [re_tests:283] trailing modifiers
2967	ok 284 # SKIP [re_tests:284] trailing modifiers
2968	ok 285 # SKIP [re_tests:285] trailing modifiers
2969	ok 286 # SKIP [re_tests:286] trailing modifiers
2970	ok 287 # SKIP [re_tests:287] trailing modifiers
2971	ok 288 # SKIP [re_tests:288] trailing modifiers
2972	ok 289 # SKIP [re_tests:289] trailing modifiers
2973	ok 290 # SKIP [re_tests:290] trailing modifiers
2974	ok 291 # SKIP [re_tests:291] trailing modifiers
2975	ok 292 # SKIP [re_tests:292] trailing modifiers
2976	ok 293 # SKIP [re_tests:293] trailing modifiers
2977	ok 294 # SKIP [re_tests:294] trailing modifiers
2978	ok 295 # SKIP [re_tests:295] trailing modifiers
2979	ok 296 # SKIP [re_tests:296] trailing modifiers
2980	ok 297 # SKIP [re_tests:297] trailing modifiers
2981	ok 298 # SKIP [re_tests:298] trailing modifiers
2982	ok 299 # SKIP [re_tests:299] trailing modifiers
2983	ok 300 # SKIP [re_tests:300] trailing modifiers
2984	ok 301 # SKIP [re_tests:301] trailing modifiers
2985	ok 302 # SKIP [re_tests:302] trailing modifiers
2986	ok 303 # SKIP [re_tests:303] trailing modifiers
2987	ok 304 # SKIP [re_tests:304] trailing modifiers
2988	ok 305 # SKIP [re_tests:305] trailing modifiers
2989	ok 306 # SKIP [re_tests:306] trailing modifiers
2990	ok 307 # SKIP [re_tests:307] trailing modifiers
2991	ok 308 # SKIP [re_tests:308] bug or error
2992	ok 309 # SKIP [re_tests:309] bug or error
2993	ok 310 # SKIP [re_tests:310] bug or error
2994	ok 311 # SKIP [re_tests:311] trailing modifiers
2995	ok 312 # SKIP [re_tests:312] trailing modifiers
2996	ok 313 # SKIP [re_tests:313] trailing modifiers
2997	ok 314 # SKIP [re_tests:314] trailing modifiers
2998	ok 315 # SKIP [re_tests:315] trailing modifiers
2999	ok 316 # SKIP [re_tests:316] trailing modifiers
3000	ok 317 # SKIP [re_tests:317] trailing modifiers
3001	ok 318 # SKIP [re_tests:318] trailing modifiers
3002	ok 319 # SKIP [re_tests:319] trailing modifiers
3003	ok 320 # SKIP [re_tests:320] trailing modifiers
3004	ok 321 # SKIP [re_tests:321] trailing modifiers
3005	ok 322 # SKIP [re_tests:322] bug or error
3006	ok 323 # SKIP [re_tests:323] bug or error
3007	ok 324 # SKIP [re_tests:324] trailing modifiers
3008	ok 325 # SKIP [re_tests:325] bug or error
3009	ok 326 # SKIP [re_tests:326] trailing modifiers
3010	ok 327 # SKIP [re_tests:327] trailing modifiers
3011	ok 328 # SKIP [re_tests:328] trailing modifiers
3012	ok 329 # SKIP [re_tests:329] trailing modifiers
3013	ok 330 # SKIP [re_tests:330] bug or error
3014	ok 331 # SKIP [re_tests:331] bug or error
3015	ok 332 # SKIP [re_tests:332] trailing modifiers
3016	ok 333 # SKIP [re_tests:333] trailing modifiers
3017	ok 334 # SKIP [re_tests:334] trailing modifiers
3018	ok 335 # SKIP [re_tests:335] trailing modifiers
3019	ok 336 # SKIP [re_tests:336] bug or error
3020	ok 337 # SKIP [re_tests:337] trailing modifiers
3021	ok 338 # SKIP [re_tests:338] trailing modifiers
3022	ok 339 # SKIP [re_tests:339] trailing modifiers
3023	ok 340 # SKIP [re_tests:340] trailing modifiers
3024	ok 341 # SKIP [re_tests:341] trailing modifiers
3025	ok 342 # SKIP [re_tests:342] trailing modifiers
3026	ok 343 # SKIP [re_tests:343] trailing modifiers
3027	ok 344 # SKIP [re_tests:344] trailing modifiers
3028	ok 345 # SKIP [re_tests:345] trailing modifiers
3029	ok 346 # SKIP [re_tests:346] trailing modifiers
3030	ok 347 # SKIP [re_tests:347] bug or error
3031	ok 348 # SKIP [re_tests:348] trailing modifiers
3032	ok 349 # SKIP [re_tests:349] trailing modifiers
3033	ok 350 # SKIP [re_tests:350] trailing modifiers
3034	ok 351 # SKIP [re_tests:351] trailing modifiers
3035	ok 352 # SKIP [re_tests:352] trailing modifiers
3036	ok 353 # SKIP [re_tests:353] trailing modifiers
3037	ok 354 # SKIP [re_tests:354] trailing modifiers
3038	ok 355 # SKIP [re_tests:355] trailing modifiers
3039	ok 356 # SKIP [re_tests:356] trailing modifiers
3040	ok 357 # SKIP [re_tests:357] trailing modifiers
3041	ok 358 # SKIP [re_tests:358] trailing modifiers
3042	ok 359 # SKIP [re_tests:359] trailing modifiers
3043	ok 360 # SKIP [re_tests:360] trailing modifiers
3044	ok 361 # SKIP [re_tests:361] trailing modifiers
3045	ok 362 # SKIP [re_tests:362] trailing modifiers
3046	ok 363 # SKIP [re_tests:363] trailing modifiers
3047	ok 364 # SKIP [re_tests:364] trailing modifiers
3048	ok 365 # SKIP [re_tests:365] trailing modifiers
3049	ok 366 # SKIP [re_tests:366] trailing modifiers
3050	ok 367 # SKIP [re_tests:367] trailing modifiers
3051	ok 368 # SKIP [re_tests:368] trailing modifiers
3052	ok 369 # SKIP [re_tests:369] trailing modifiers
3053	ok 370 # SKIP [re_tests:370] trailing modifiers
3054	ok 371 # SKIP [re_tests:371] trailing modifiers
3055	ok 372 # SKIP [re_tests:372] trailing modifiers
3056	ok 373 # SKIP [re_tests:373] trailing modifiers
3057	ok 374 # SKIP [re_tests:374] trailing modifiers
3058	ok 375 # SKIP [re_tests:375] trailing modifiers
3059	ok 376 # SKIP [re_tests:376] trailing modifiers
3060	ok 377 # SKIP [re_tests:377] trailing modifiers
3061	ok 378 # SKIP [re_tests:378] trailing modifiers
3062	ok 379 # SKIP [re_tests:379] trailing modifiers
3063	ok 380 # SKIP [re_tests:380] trailing modifiers
3064	ok 381 # SKIP [re_tests:381] trailing modifiers
3065	ok 382 # SKIP [re_tests:382] trailing modifiers
3066	ok 383 # SKIP [re_tests:383] trailing modifiers
3067	ok 384 # SKIP [re_tests:384] trailing modifiers
3068	ok 385 # SKIP [re_tests:385] trailing modifiers
3069	ok 386 # SKIP [re_tests:386] trailing modifiers
3070	ok 387 # SKIP [re_tests:387] trailing modifiers
3071	ok 388 # SKIP [re_tests:388] trailing modifiers
3072	ok 389 # SKIP [re_tests:389] trailing modifiers
3073	ok 390 # SKIP [re_tests:390] trailing modifiers
3074	ok 391 # SKIP [re_tests:391] trailing modifiers
3075	ok 392 # SKIP [re_tests:392] trailing modifiers
3076	ok 393 # SKIP [re_tests:393] trailing modifiers
3077	ok 394 # SKIP [re_tests:394] trailing modifiers
3078	ok 395 # SKIP [re_tests:395] trailing modifiers
3079	not ok 396 # TODO [re_tests:396] unknown reason
3080	not ok 397 # TODO [re_tests:397] unknown reason
3081	not ok 398 # TODO [re_tests:398] unknown reason
3082	ok 408 # SKIP [re_tests:408] bug or error
3083	not ok 419 # TODO [re_tests:419] unknown reason
3084	not ok 422 # TODO [re_tests:422] unknown reason
3085	not ok 429 # TODO [re_tests:429] unknown reason
3086	not ok 432 # TODO [re_tests:432] unknown reason
3087	not ok 434 # TODO [re_tests:434] unknown reason
3088	not ok 435 # TODO [re_tests:435] unknown reason
3089	ok 436 # SKIP [re_tests:436] bug or error
3090	not ok 439 # TODO [re_tests:439] unknown reason
3091	not ok 446 # TODO [re_tests:446] unknown reason
3092	not ok 447 # TODO [re_tests:447] unknown reason
3093	not ok 448 # TODO [re_tests:448] unknown reason
3094	not ok 449 # TODO [re_tests:449] unknown reason
3095	not ok 452 # TODO [re_tests:452] unknown reason
3096	not ok 453 # TODO [re_tests:453] unknown reason
3097	not ok 454 # TODO [re_tests:454] unknown reason
3098	not ok 455 # TODO [re_tests:455] unknown reason
3099	ok 458 # SKIP [re_tests:458] unknown reason
3100	ok 459 # SKIP [re_tests:459] unknown reason
3101	ok 460 # SKIP [re_tests:460] unknown reason
3102	ok 461 # SKIP [re_tests:461] unknown reason
3103	ok 462 # SKIP [re_tests:462] unknown reason
3104	ok 463 # SKIP [re_tests:463] unknown reason
3105	ok 464 # SKIP [re_tests:464] unknown reason
3106	ok 465 # SKIP [re_tests:465] unknown reason
3107	ok 466 # SKIP [re_tests:466] unknown reason
3108	ok 467 # SKIP [re_tests:467] unknown reason
3109	ok 468 # SKIP [re_tests:468] unknown reason
3110	ok 469 # SKIP [re_tests:469] unknown reason
3111	ok 470 # SKIP [re_tests:470] unknown reason
3112	ok 471 # SKIP [re_tests:471] unknown reason
3113	ok 472 # SKIP [re_tests:472] unknown reason
3114	ok 473 # SKIP [re_tests:473] unknown reason
3115	ok 474 # SKIP [re_tests:474] unknown reason
3116	ok 475 # SKIP [re_tests:475] unknown reason
3117	ok 476 # SKIP [re_tests:476] unknown reason
3118	ok 477 # SKIP [re_tests:477] unknown reason
3119	ok 478 # SKIP [re_tests:478] unknown reason
3120	ok 479 # SKIP [re_tests:479] unknown reason
3121	ok 480 # SKIP [re_tests:480] unknown reason
3122	ok 483 # SKIP [re_tests:483]
3123	ok 484 # SKIP [re_tests:484]
3124	ok 487 # SKIP [re_tests:487] bug or error
3125	ok 488 # SKIP [re_tests:488] bug or error
3126	ok 489 # SKIP [re_tests:489] bug or error
3127	ok 490 # SKIP [re_tests:490] bug or error
3128	ok 491 # SKIP [re_tests:491] kills a parrot
3129	ok 492 # SKIP [re_tests:492] bug or error
3130	ok 493 # SKIP [re_tests:493] kills a parrot
3131	not ok 495 # TODO [re_tests:495] unknown reason
3132	ok 496 # SKIP [re_tests:496]
3133	not ok 498 # TODO [re_tests:498] unknown reason
3134	not ok 500 # TODO [re_tests:500] unknown reason
3135	not ok 501 # TODO [re_tests:501] unknown reason
3136	ok 502 # SKIP [re_tests:502] unknown reason
3137	not ok 503 # TODO [re_tests:503] unknown reason
3138	not ok 504 # TODO [re_tests:504] unknown reason
3139	not ok 505 # TODO [re_tests:505] unknown reason
3140	not ok 506 # TODO [re_tests:506] unknown reason
3141	not ok 507 # TODO [re_tests:507] unknown reason
3142	not ok 508 # TODO [re_tests:508] unknown reason
3143	not ok 509 # TODO [re_tests:509] unknown reason
3144	not ok 510 # TODO [re_tests:510] unknown reason
3145	not ok 511 # TODO [re_tests:511] unknown reason
3146	not ok 512 # TODO [re_tests:512] unknown reason
3147	not ok 515 # TODO [re_tests:515] unknown reason
3148	not ok 521 # TODO [re_tests:521] unknown reason
3149	not ok 522 # TODO [re_tests:522] unknown reason
3150	not ok 523 # TODO [re_tests:523] unknown reason
3151	not ok 524 # TODO [re_tests:524] unknown reason
3152	not ok 527 # TODO [re_tests:527] unknown reason
3153	not ok 528 # TODO [re_tests:528] unknown reason
3154	ok 531 # SKIP [re_tests:531] bug or error
3155	ok 532 # SKIP [re_tests:532] bug or error
3156	not ok 535 # TODO [re_tests:535] unknown reason
3157	not ok 536 # TODO [re_tests:536] unknown reason
3158	not ok 539 # TODO [re_tests:539] unknown reason
3159	not ok 540 # TODO [re_tests:540] unknown reason
3160	not ok 541 # TODO [re_tests:541] unknown reason
3161	not ok 544 # TODO [re_tests:544] unknown reason
3162	not ok 545 # TODO [re_tests:545] unknown reason
3163	ok 556 # SKIP [re_tests:556] kills a parrot
3164	ok 557 # SKIP [re_tests:557] kills a parrot
3165	not ok 559 # TODO [re_tests:559] unknown reason
3166	ok 563 # SKIP [re_tests:563] bug or error
3167	ok 564 # SKIP [re_tests:564] bug or error
3168	ok 566 # SKIP [re_tests:566] bug or error
3169	ok 568 # SKIP [re_tests:568] kills a parrot
3170	ok 569 # SKIP [re_tests:569] kills a parrot
3171	ok 570 # SKIP [re_tests:570] kills a parrot
3172	ok 571 # SKIP [re_tests:571] kills a parrot
3173	ok 572 # SKIP [re_tests:572] kills a parrot
3174	ok 573 # SKIP [re_tests:573] kills a parrot
3175	ok 574 # SKIP [re_tests:574] kills a parrot
3176	ok 575 # SKIP [re_tests:575] kills a parrot
3177	ok 576 # SKIP [re_tests:576] kills a parrot
3178	ok 577 # SKIP [re_tests:577] kills a parrot
3179	ok 578 # SKIP [re_tests:578] kills a parrot
3180	ok 579 # SKIP [re_tests:579] kills a parrot
3181	ok 580 # SKIP [re_tests:580] kills a parrot
3182	ok 581 # SKIP [re_tests:581] kills a parrot
3183	ok 582 # SKIP [re_tests:582] kills a parrot
3184	ok 583 # SKIP [re_tests:583] kills a parrot
3185	ok 584 # SKIP [re_tests:584] kills a parrot
3186	ok 585 # SKIP [re_tests:585] kills a parrot
3187	ok 586 # SKIP [re_tests:586] kills a parrot
3188	ok 587 # SKIP [re_tests:587] kills a parrot
3189	ok 588 # SKIP [re_tests:588] kills a parrot
3190	ok 589 # SKIP [re_tests:589] kills a parrot
3191	ok 590 # SKIP [re_tests:590] kills a parrot
3192	ok 591 # SKIP [re_tests:591] kills a parrot
3193	ok 592 # SKIP [re_tests:592] kills a parrot
3194	ok 593 # SKIP [re_tests:593] bug or error
3195	ok 594 # SKIP [re_tests:594] bug or error
3196	not ok 595 # TODO [re_tests:595] unknown reason
3197	not ok 596 # TODO [re_tests:596] unknown reason
3198	ok 597 # SKIP [re_tests:597] unknown reason
3199	ok 598 # SKIP [re_tests:598] bug or error
3200	ok 599 # SKIP [re_tests:599] bug or error
3201	not ok 600 # TODO [re_tests:600] unknown reason
3202	not ok 601 # TODO [re_tests:601] unknown reason
3203	not ok 603 # TODO [re_tests:603] unknown reason
3204	not ok 604 # TODO [re_tests:604] unknown reason
3205	not ok 606 # TODO [re_tests:606] unknown reason
3206	not ok 607 # TODO [re_tests:607] unknown reason
3207	ok 609 # SKIP [re_tests:609] unknown reason
3208	ok 610 # SKIP [re_tests:610] unknown reason
3209	ok 611 # SKIP [re_tests:611] unknown reason
3210	ok 612 # SKIP [re_tests:612] unknown reason
3211	ok 613 # SKIP [re_tests:613] unknown reason
3212	ok 614 # SKIP [re_tests:614] unknown reason
3213	ok 615 # SKIP [re_tests:615] unknown reason
3214	ok 616 # SKIP [re_tests:616] unknown reason
3215	ok 617 # SKIP [re_tests:617] unknown reason
3216	not ok 621 # TODO [re_tests:621] unknown reason
3217	not ok 623 # TODO [re_tests:623] unknown reason
3218	not ok 624 # TODO [re_tests:624] unknown reason
3219	not ok 625 # TODO [re_tests:625] unknown reason
3220	ok 627 # SKIP [re_tests:627] unknown reason
3221	ok 628 # SKIP [re_tests:628] unknown reason
3222	ok 629 # SKIP [re_tests:629] unknown reason
3223	ok 630 # SKIP [re_tests:630] unknown reason
3224	ok 631 # SKIP [re_tests:631] unknown reason
3225	ok 632 # SKIP [re_tests:632] unknown reason
3226	ok 633 # SKIP [re_tests:633] unknown reason
3227	ok 634 # SKIP [re_tests:634] unknown reason
3228	ok 635 # SKIP [re_tests:635] unknown reason
3229	not ok 639 # TODO [re_tests:639] unknown reason
3230	not ok 641 # TODO [re_tests:641] unknown reason
3231	not ok 642 # TODO [re_tests:642] unknown reason
3232	not ok 643 # TODO [re_tests:643] unknown reason
3233	ok 645 # SKIP [re_tests:645] unknown reason
3234	ok 646 # SKIP [re_tests:646] unknown reason
3235	ok 647 # SKIP [re_tests:647] unknown reason
3236	ok 648 # SKIP [re_tests:648] unknown reason
3237	ok 649 # SKIP [re_tests:649] unknown reason
3238	ok 650 # SKIP [re_tests:650] unknown reason
3239	ok 651 # SKIP [re_tests:651] unknown reason
3240	ok 652 # SKIP [re_tests:652] unknown reason
3241	ok 653 # SKIP [re_tests:653] unknown reason
3242	ok 663 # SKIP [re_tests:663] unknown reason
3243	ok 664 # SKIP [re_tests:664] unknown reason
3244	ok 665 # SKIP [re_tests:665] unknown reason
3245	ok 666 # SKIP [re_tests:666] unknown reason
3246	ok 667 # SKIP [re_tests:667] unknown reason
3247	ok 668 # SKIP [re_tests:668] unknown reason
3248	ok 669 # SKIP [re_tests:669] unknown reason
3249	ok 670 # SKIP [re_tests:670] unknown reason
3250	ok 671 # SKIP [re_tests:671] unknown reason
3251	ok 681 # SKIP [re_tests:681] unknown reason
3252	ok 682 # SKIP [re_tests:682] unknown reason
3253	ok 683 # SKIP [re_tests:683] unknown reason
3254	ok 684 # SKIP [re_tests:684] unknown reason
3255	ok 685 # SKIP [re_tests:685] unknown reason
3256	ok 686 # SKIP [re_tests:686] unknown reason
3257	ok 687 # SKIP [re_tests:687] unknown reason
3258	ok 688 # SKIP [re_tests:688] unknown reason
3259	ok 689 # SKIP [re_tests:689] unknown reason
3260	not ok 693 # TODO [re_tests:693] unknown reason
3261	not ok 695 # TODO [re_tests:695] unknown reason
3262	not ok 696 # TODO [re_tests:696] unknown reason
3263	not ok 697 # TODO [re_tests:697] unknown reason
3264	ok 699 # SKIP [re_tests:699] unknown reason
3265	ok 700 # SKIP [re_tests:700] unknown reason
3266	ok 701 # SKIP [re_tests:701] unknown reason
3267	ok 702 # SKIP [re_tests:702] unknown reason
3268	ok 703 # SKIP [re_tests:703] unknown reason
3269	ok 704 # SKIP [re_tests:704] unknown reason
3270	ok 705 # SKIP [re_tests:705] unknown reason
3271	ok 706 # SKIP [re_tests:706] unknown reason
3272	ok 707 # SKIP [re_tests:707] unknown reason
3273	ok 717 # SKIP [re_tests:717] unknown reason
3274	ok 718 # SKIP [re_tests:718] unknown reason
3275	ok 719 # SKIP [re_tests:719] unknown reason
3276	ok 720 # SKIP [re_tests:720] unknown reason
3277	ok 721 # SKIP [re_tests:721] unknown reason
3278	ok 722 # SKIP [re_tests:722] unknown reason
3279	ok 723 # SKIP [re_tests:723] unknown reason
3280	ok 724 # SKIP [re_tests:724] unknown reason
3281	ok 725 # SKIP [re_tests:725] unknown reason
3282	ok 735 # SKIP [re_tests:735] unknown reason
3283	ok 736 # SKIP [re_tests:736] unknown reason
3284	ok 737 # SKIP [re_tests:737] unknown reason
3285	ok 738 # SKIP [re_tests:738] unknown reason
3286	ok 739 # SKIP [re_tests:739] unknown reason
3287	ok 740 # SKIP [re_tests:740] unknown reason
3288	ok 741 # SKIP [re_tests:741] unknown reason
3289	ok 742 # SKIP [re_tests:742] unknown reason
3290	ok 743 # SKIP [re_tests:743] unknown reason
3291	not ok 747 # TODO [re_tests:747] unknown reason
3292	not ok 749 # TODO [re_tests:749] unknown reason
3293	not ok 750 # TODO [re_tests:750] unknown reason
3294	not ok 751 # TODO [re_tests:751] unknown reason
3295	ok 753 # SKIP [re_tests:753] unknown reason
3296	ok 754 # SKIP [re_tests:754] unknown reason
3297	ok 755 # SKIP [re_tests:755] unknown reason
3298	ok 756 # SKIP [re_tests:756] unknown reason
3299	ok 757 # SKIP [re_tests:757] unknown reason
3300	ok 758 # SKIP [re_tests:758] unknown reason
3301	ok 759 # SKIP [re_tests:759] unknown reason
3302	ok 760 # SKIP [re_tests:760] unknown reason
3303	ok 761 # SKIP [re_tests:761] unknown reason
3304	ok 771 # SKIP [re_tests:771] unknown reason
3305	ok 772 # SKIP [re_tests:772] unknown reason
3306	ok 773 # SKIP [re_tests:773] unknown reason
3307	ok 774 # SKIP [re_tests:774] unknown reason
3308	ok 775 # SKIP [re_tests:775] unknown reason
3309	ok 776 # SKIP [re_tests:776] unknown reason
3310	ok 777 # SKIP [re_tests:777] unknown reason
3311	ok 778 # SKIP [re_tests:778] unknown reason
3312	ok 779 # SKIP [re_tests:779] unknown reason
3313	ok 789 # SKIP [re_tests:789] unknown reason
3314	ok 790 # SKIP [re_tests:790] unknown reason
3315	ok 791 # SKIP [re_tests:791] unknown reason
3316	ok 792 # SKIP [re_tests:792] unknown reason
3317	ok 793 # SKIP [re_tests:793] unknown reason
3318	ok 794 # SKIP [re_tests:794] unknown reason
3319	ok 795 # SKIP [re_tests:795] unknown reason
3320	ok 796 # SKIP [re_tests:796] unknown reason
3321	ok 797 # SKIP [re_tests:797] unknown reason
3322	ok 800 # SKIP [re_tests:800]
3323	not ok 801 # TODO [re_tests:801] unknown reason
3324	ok 802 # SKIP [re_tests:802]
3325	ok 803 # SKIP [re_tests:803]
3326	ok 805 # SKIP [re_tests:805]
3327	ok 806 # SKIP [re_tests:806] hangs a parrot
3328	ok 807 # SKIP [re_tests:807] hangs a parrot
3329	ok 808 # SKIP [re_tests:808] hangs a parrot
3330	ok 809 # SKIP [re_tests:809] hangs a parrot
3331	ok 810 # SKIP [re_tests:810] hangs a parrot
3332	ok 811 # SKIP [re_tests:811] hangs a parrot
3333	ok 812 # SKIP [re_tests:812] hangs a parrot
3334	ok 813 # SKIP [re_tests:813] hangs a parrot
3335	ok 814 # SKIP [re_tests:814] hangs a parrot
3336	ok 815 # SKIP [re_tests:815] hangs a parrot
3337	ok 816 # SKIP [re_tests:816] hangs a parrot
3338	ok 817 # SKIP [re_tests:817] hangs a parrot
3339	ok 818 # SKIP [re_tests:818] hangs a parrot
3340	ok 819 # SKIP [re_tests:819] hangs a parrot
3341	ok 820 # SKIP [re_tests:820] hangs a parrot
3342	ok 821 # SKIP [re_tests:821] hangs a parrot
3343	ok 822 # SKIP [re_tests:822] hangs a parrot
3344	ok 823 # SKIP [re_tests:823] hangs a parrot
3345	not ok 827 # TODO [re_tests:827] \d in character class
3346	ok 828 # SKIP [re_tests:828]
3347	ok 829 # SKIP [re_tests:829]
3348	ok 830 # SKIP [re_tests:830]
3349	ok 834 # SKIP [re_tests:834]
3350	ok 835 # SKIP [re_tests:835]
3351	ok 836 # SKIP [re_tests:836]
3352	ok 838 # SKIP [re_tests:838]
3353	not ok 858 # TODO [re_tests:858] unknown reason
3354	ok 859 # SKIP [re_tests:859]
3355	ok 862 # SKIP [re_tests:862]
3356	not ok 865 # TODO [re_tests:865] unknown reason
3357	not ok 866 # TODO [re_tests:866] unknown reason
3358	ok 877 # SKIP [re_tests:877]
3359	ok 879 # SKIP [re_tests:879] [ID 20010811.006]
3360	not ok 881 # TODO [re_tests:881] unknown reason
3361	ok 886 # SKIP [re_tests:886]
3362	not ok 887 # TODO [re_tests:887] unknown reason
3363	not ok 888 # TODO [re_tests:888] unknown reason
3364	not ok 890 # TODO [re_tests:890] unknown reason
3365	not ok 891 # TODO [re_tests:891] unknown reason
3366	not ok 893 # TODO [re_tests:893] unknown reason
3367	not ok 896 # TODO [re_tests:896] unknown reason
3368	not ok 897 # TODO [re_tests:897] unknown reason
3369	not ok 898 # TODO [re_tests:898] unknown reason
3370	not ok 899 # TODO [re_tests:899] unknown reason
3371	not ok 901 # TODO [re_tests:901] greediness/lookbehind
3372	not ok 904 # TODO [re_tests:904] greediness/lookbehind
3373	not ok 905 # TODO [re_tests:905] greediness/lookbehind
3374	not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion
3375	not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion
3376	not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion
3377	not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion
3378	not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion
3379	not ok 915 # TODO [re_tests:915] non-greedy/lookbehind
3380	not ok 916 # TODO [re_tests:916] non-greedy/lookbehind
3381	not ok 918 # TODO [re_tests:918] non-greedy/lookbehind
3382	not ok 921 # TODO [re_tests:921] non-greedy/lookbehind
3383	not ok 922 # TODO [re_tests:922] non-greedy/lookbehind
3384	not ok 923 # TODO [re_tests:923] unmatched bracket
3385	ok 924 # SKIP [re_tests:924]
3386	ok 926 # SKIP [re_tests:926] [perl #18019]
3387	not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171]
3388	not ok 928 # TODO [re_tests:928] reuse captured group
3389	not ok 929 # TODO [re_tests:929] reuse captured group
3390	not ok 930 # TODO [re_tests:930] reuse captured group
3391	not ok 931 # TODO [re_tests:931] reuse captured group
3392	not ok 932 # TODO [re_tests:932] reuse captured group
3393	not ok 933 # TODO [re_tests:933] reuse captured group
3394	not ok 934 # TODO [re_tests:934] reuse captured group
3395	not ok 935 # TODO [re_tests:935] reuse captured group
3396	not ok 936 # TODO [re_tests:936] reuse captured group
3397	not ok 937 # TODO [re_tests:937] reuse captured group
3398	not ok 938 # TODO [re_tests:938] reuse captured group
3399	not ok 939 # TODO [re_tests:939] reuse captured group
3400	not ok 940 # TODO [re_tests:940] reuse captured group
3401	not ok 941 # TODO [re_tests:941] reuse captured group
3402	not ok 942 # TODO [re_tests:942] reuse captured group
3403	ok 944 # SKIP [re_tests:944] unknown reason
3404	ok 945 # SKIP [re_tests:945] unknown reason
3405	ok 957 # SKIP [re_tests:957]
3406	ok 958 # SKIP [re_tests:958]
3407	not ok 959 # TODO [re_tests:959] [perl #34195]
3408	not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion
3409	ok
3410	t/compilers/pge/perl6regex/01-regex....
3411	not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&\|) - parse error
3412	not ok 99 # TODO [rx_metachars:114] null pattern invalid
3413	not ok 386 # TODO [rx_backtrack:4] basic
3414	not ok 427 # TODO [rx_charclass:26] illegal character range
3415	not ok 458 # TODO [rx_charclass:62] literal match (\")
3416	not ok 459 # TODO [rx_charclass:64] literal match (\")
3417	not ok 460 # TODO [rx_charclass:66] literal match with quote
3418	not ok 461 # TODO [rx_charclass:68] literal match with quote
3419	not ok 462 # TODO [rx_charclass:70] literal match with backslash
3420	not ok 463 # TODO [rx_charclass:72] literal match with interpolation
3421	not ok 464 # TODO [rx_charclass:74] literal match with interpolation
3422	not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i)
3423	not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s)
3424	not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s)
3425	not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s)
3426	not ok 709 # TODO [rx_modifiers:131] basic ws match
3427	not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5)
3428	not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth)
3429	not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth)
3430	ok
3431	t/compilers/pge/perl6regex/context.....
3432	not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented
3433	ok
3434	t/compilers/tge/basic..................ok
3435	t/compilers/tge/grammar................
3436	not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug
3437	ok
3438	t/compilers/tge/parser.................ok
3439	t/library/cgi_query_hash...............ok
3440	t/library/coroutine....................ok
3441	t/library/dumper.......................ok
3442	t/library/getopt_obj...................ok
3443	t/library/hllmacros....................ok
3444	t/library/iter.........................ok
3445	t/library/md5..........................ok
3446	t/library/mime_base64..................ok
3447	t/library/mt19937ar....................ok
3448	t/library/p6object.....................
3449	not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) >
3450	ok
3451	t/library/parrotlib....................ok
3452	t/library/pcre.........................
3453	ok 1 # SKIP no pcre-config
3454	ok
3455	t/library/pg...........................
3456	ok 1 # SKIP skipped
3457	ok 2 # SKIP skipped
3458	ok 3 # SKIP skipped
3459	ok 4 # SKIP skipped
3460	ok 5 # SKIP skipped
3461	ok 6 # SKIP skipped
3462	ok 7 # SKIP skipped
3463	ok 8 # SKIP skipped
3464	ok 9 # SKIP skipped
3465	ok 10 # SKIP skipped
3466	ok 11 # SKIP skipped
3467	ok 12 # SKIP skipped
3468	ok 13 # SKIP skipped
3469	ok 14 # SKIP skipped
3470	ok 15 # SKIP skipped
3471	ok 16 # SKIP skipped
3472	ok 17 # SKIP skipped
3473	ok 18 # SKIP skipped
3474	ok 19 # SKIP skipped
3475	ok 20 # SKIP skipped
3476	ok 21 # SKIP skipped
3477	ok 22 # SKIP skipped
3478	ok 23 # SKIP skipped
3479	ok 24 # SKIP skipped
3480	ok 25 # SKIP skipped
3481	ok 26 # SKIP skipped
3482	ok 27 # SKIP skipped
3483	ok 28 # SKIP skipped
3484	ok 29 # SKIP skipped
3485	ok 30 # SKIP skipped
3486	ok 31 # SKIP skipped
3487	ok 32 # SKIP skipped
3488	ok 33 # SKIP skipped
3489	ok 34 # SKIP skipped
3490	ok 35 # SKIP skipped
3491	ok 36 # SKIP skipped
3492	ok 37 # SKIP skipped
3493	ok 38 # SKIP skipped
3494	ok 39 # SKIP skipped
3495	ok 40 # SKIP skipped
3496	ok 41 # SKIP skipped
3497	ok 42 # SKIP skipped
3498	ok 43 # SKIP skipped
3499	ok
3500	t/library/protoobject..................ok
3501	t/library/rand.........................ok
3502	t/library/range........................ok
3503	t/library/streams......................
3504	ok 18 # SKIP broken method invocation
3505	ok 20 # SKIP broken method invocation
3506	ok
3507	t/library/string_utils.................ok
3508	t/library/tcl_glob.....................ok
3509	t/library/tcl_lib......................ok
3510	t/library/test_builder_tester..........ok
3511	t/library/test_class...................ok
3512	t/library/test_more....................ok
3513	t/library/uuid.........................ok
3514	t/library/yaml_dumper..................
3515	not ok 7 - properties # TODO not yet implemented
3516	not ok 8 - indent string # TODO not supported
3517	not ok 9 - back-referencing properties # TODO not yet implemented
3518	not ok 10 - self-referential properties (1) # TODO not yet implemented
3519	not ok 11 - self-referential properties (2) # TODO not yet implemented
3520	not ok 26 - custom dumper # TODO not yet implemented
3521	ok
3522	t/library/yaml_parser_syck.............
3523	not ok 1 - basic parsing # TODO Not properly implemented yet
3524	ok
3525	All tests successful.
3526	Files=252, Tests=8326, 418 wallclock secs ( 5.94 usr 4.03 sys + 184.52 cusr 111.58 csys = 306.07 CPU)
3527	Result: PASS
3528	perl t/harness --gc-debug --running-make-test -g --runcore-tests
3529	t/compilers/imcc/imcpasm/cfg...........ok
3530	t/compilers/imcc/imcpasm/opt0..........
3531	ok 1 # SKIP disabled graph coloring register allocator, RT #57028
3532	ok 3 # SKIP disabled graph coloring register allocator, RT #57028
3533	ok
3534	t/compilers/imcc/imcpasm/opt1..........
3535	ok 76 # SKIP constant concat N/Y
3536	ok
3537	t/compilers/imcc/imcpasm/opt2..........
3538	ok 5 # SKIP loop opt disabled for now
3539	ok
3540	t/compilers/imcc/imcpasm/optc..........
3541	not ok 9 - tailcall 1 # TODO RT #57028
3542	ok
3543	t/compilers/imcc/imcpasm/pcc...........ok
3544	t/compilers/imcc/imcpasm/sub...........ok
3545	t/compilers/imcc/reg/alloc.............ok
3546	t/compilers/imcc/reg/spill.............ok
3547	t/compilers/imcc/syn/bsr...............ok
3548	t/compilers/imcc/syn/clash.............
3549	not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet
3550	ok
3551	t/compilers/imcc/syn/const.............ok
3552	t/compilers/imcc/syn/errors............ok
3553	t/compilers/imcc/syn/eval..............
3554	ok 1 # SKIP changed eval semantics - see t/pmc/eval.t
3555	ok 2 # SKIP changed eval semantics - see t/pmc/eval.t
3556	ok 3 # SKIP changed eval semantics - see t/pmc/eval.t
3557	ok 4 # SKIP changed eval semantics - see t/pmc/eval.t
3558	ok 5 # SKIP changed eval semantics - see t/pmc/eval.t
3559	ok 6 # SKIP changed eval semantics - see t/pmc/eval.t
3560	ok 7 # SKIP changed eval semantics - see t/pmc/eval.t
3561	ok
3562	t/compilers/imcc/syn/file..............
3563	ok 13 # SKIP multiple loading not speced - failing
3564	ok
3565	t/compilers/imcc/syn/hll...............ok
3566	t/compilers/imcc/syn/keyed.............
3567	ok 1 # SKIP experimental
3568	ok
3569	t/compilers/imcc/syn/labels............ok
3570	t/compilers/imcc/syn/macro.............
3571	not ok 25 - unterminated macro 2 # TODO Darwin segfault -- RT #60926
3572	ok
3573	t/compilers/imcc/syn/objects...........ok
3574	t/compilers/imcc/syn/op................ok
3575	t/compilers/imcc/syn/pasm..............ok
3576	t/compilers/imcc/syn/pcc...............ok
3577	t/compilers/imcc/syn/pod...............
3578	ok 4 # SKIP Closing out of pod from included files
3579	ok
3580	t/compilers/imcc/syn/regressions.......
3581	not ok 4 - comments between .param(RT \#46499) # TODO broken
3582	not ok 6 - whitespace between .param(RT \#46499) # TODO broken
3583	not ok 7 - off by one error message (RT \#40204) # TODO broken
3584	ok
3585	t/compilers/imcc/syn/scope.............ok
3586	t/compilers/imcc/syn/subflags..........
3587	not ok 15 # TODO :method sub not found in namespace
3588	ok
3589	t/compilers/imcc/syn/symbols...........ok
3590	t/compilers/imcc/syn/tail..............ok
3591	t/compilers/imcc/syn/veracity..........ok
3592	t/op/00ff-dos..........................ok
3593	t/op/00ff-unix.........................ok
3594	t/op/01-parse_ops......................ok
3595	t/op/64bit.............................
3596	1..0 # Skip 64bit INTVAL platforms only
3597	skipped: 64bit INTVAL platforms only
3598	t/op/annotate..........................ok
3599	t/op/arithmetics.......................
3600	ok 28 # SKIP No integer overflow for 32-bit INTVALs without GMP installed
3601	ok
3602	t/op/basic.............................ok
3603	t/op/bitwise...........................
3604	ok 27 # SKIP no BigInt lib found
3605	ok
3606	t/op/box...............................ok
3607	t/op/calling...........................
3608	not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all
3609	not ok 93 - arg mismatch with no params # TODO RT #39844
3610	ok
3611	t/op/cc_params.........................ok
3612	t/op/cc_state..........................
3613	not ok 6 - positional found, named expected # TODO cc processor state missing
3614	not ok 8 - G2: argument underflow: required slurpy param # TODO failing
3615	ok
3616	t/op/cmp-nonbranch.....................ok
3617	t/op/comp..............................ok
3618	t/op/copy..............................ok
3619	t/op/debuginfo.........................
3620	ok 1 # SKIP disabled on fast-core
3621	ok 7 # SKIP disabled on this core
3622	ok 8 # SKIP disabled on this core
3623	ok
3624	t/op/exceptions........................
3625	not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans
3626	ok
3627	t/op/gc................................ok
3628	t/op/globals...........................ok
3629	t/op/hacks.............................
3630	ok 1 # SKIP no universal SIGFPE handling
3631	ok 2 # SKIP no universal SIGFPE handling
3632	ok
3633	t/op/ifunless..........................ok
3634	t/op/integer...........................ok
3635	t/op/interp............................
3636	ok 1 # SKIP we really shouldn't run just a label - use a sub
3637	ok
3638	t/op/io................................ok
3639	t/op/jit...............................ok
3640	t/op/jitn..............................ok
3641	t/op/lexicals..........................
3642	not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented
3643	ok
3644	t/op/literal...........................ok
3645	t/op/load_bytecode.....................ok
3646	t/op/number............................ok
3647	t/op/pushaction........................
3648	not ok 7 - pushaction: error while handling error # TODO runloop shenanigans
3649	ok
3650	t/op/say...............................ok
3651	t/op/spawnw............................ok
3652	t/op/sprintf...........................
3653	ok 5 # SKIP parrot extension (%B)
3654	ok 7 # SKIP perl5-specific extension (%D)
3655	ok 9 # SKIP perl5-specific extension (%F)
3656	ok 16 # SKIP parrot extension (%H)
3657	ok 20 # SKIP parrot extension (%L)
3658	ok 23 # SKIP perl5-specific extension (%O)
3659	ok 24 # SKIP parrot extension (%P)
3660	ok 27 # SKIP parrot extension (%S)
3661	ok 29 # SKIP perl5-specific extension (%U)
3662	not ok 64 # TODO [%03.2d] actual: > 01<
3663	ok 71 # SKIP perl5-specific extension (%v...)
3664	ok 72 # SKIP perl5-specific extension (%v...)
3665	ok 73 # SKIP perl5-specific extension (%v...)
3666	ok 74 # SKIP perl5-specific extension (%v...)
3667	ok 75 # SKIP perl5-specific extension (%v...)
3668	ok 76 # SKIP perl5-specific extension (%v...)
3669	ok 77 # SKIP perl5-specific extension (%v...)
3670	ok 78 # SKIP perl5-specific extension (%v...)
3671	ok 79 # SKIP perl5-specific extension (%v...)
3672	ok 80 # SKIP perl5-specific extension (%v...)
3673	ok 81 # SKIP perl5-specific extension (%v...)
3674	ok 82 # SKIP perl5-specific extension (%v...)
3675	ok 83 # SKIP perl5-specific extension (%v...)
3676	ok 84 # SKIP perl5-specific extension (%v...)
3677	ok 85 # SKIP perl5-specific extension (%v...)
3678	ok 86 # SKIP perl5-specific extension (%v...)
3679	ok 87 # SKIP perl5-specific extension (%v...)
3680	ok 88 # SKIP perl5-specific extension (%v...)
3681	ok 89 # SKIP perl5-specific extension (%v...)
3682	ok 90 # SKIP perl5-specific extension (%v...)
3683	ok 91 # SKIP perl5-specific extension (%v...)
3684	ok 92 # SKIP perl5-specific extension (%v...)
3685	ok 93 # SKIP perl5-specific extension (%v...)
3686	ok 94 # SKIP perl5-specific extension (%v...)
3687	ok 95 # SKIP perl5-specific extension (%v...)
3688	ok 96 # SKIP perl5-specific extension (%v...)
3689	ok 97 # SKIP perl5-specific extension (%v...)
3690	ok 98 # SKIP perl5-specific extension (%v...)
3691	ok 99 # SKIP perl5-specific extension (%v...)
3692	ok 114 # SKIP harness needs support for * modifier
3693	ok 131 # SKIP harness needs support for * modifier
3694	ok 141 # SKIP harness needs support for * modifier
3695	ok 144 # SKIP perl5 expresssion as test value
3696	not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1<
3697	ok 161 # SKIP harness needs support for * modifier
3698	ok 166 # SKIP harness needs support for * modifier
3699	not ok 187 # TODO [%h] actual: ><
3700	not ok 191 # TODO [%l] actual: ><
3701	ok 193 # SKIP perl5-specific test
3702	ok 200 # SKIP perl5-specific test
3703	ok 201 # SKIP perl5-specific test
3704	ok 202 # SKIP parrot extension (%p)
3705	ok 204 # SKIP parrot extension (%r)
3706	ok 210 # SKIP harness needs support for * modifier
3707	ok 214 # SKIP harness needs support for * modifier
3708	not ok 223 # TODO [%v] actual: ><
3709	ok 233 # SKIP harness needs support for * modifier
3710	ok 234 # SKIP perl5-specific extension (%v...)
3711	ok 235 # SKIP perl5-specific extension (%v...)
3712	ok 238 # SKIP perl5-specific test
3713	ok 239 # SKIP perl5-specific test
3714	ok 240 # SKIP perl5-specific test
3715	ok 241 # SKIP perl5-specific test
3716	ok 242 # SKIP perl5-specific test
3717	ok 243 # SKIP perl5-specific test
3718	ok 244 # SKIP perl5-specific test
3719	ok 245 # SKIP perl5-specific test
3720	ok 246 # SKIP perl5-specific test
3721	ok 247 # SKIP perl5-specific test
3722	ok 248 # SKIP perl5-specific test
3723	ok 249 # SKIP perl5-specific test
3724	ok 250 # SKIP perl5-specific test
3725	ok 251 # SKIP perl5-specific test
3726	ok 252 # SKIP perl5-specific extension (%v...)
3727	ok 253 # SKIP perl5-specific extension (%v...)
3728	ok 254 # SKIP perl5-specific extension (%v...)
3729	ok 255 # SKIP perl5-specific extension (%v...)
3730	ok 256 # SKIP perl5-specific extension (%v...)
3731	ok 257 # SKIP perl5-specific extension (%v...)
3732	ok 258 # SKIP perl5-specific extension (%v...)
3733	ok 259 # SKIP perl5-specific extension (%v...)
3734	ok 260 # SKIP perl5-specific extension (%v...)
3735	ok 261 # SKIP perl5-specific extension (%v...)
3736	ok 262 # SKIP perl5-specific extension (%v...)
3737	ok 263 # SKIP perl5-specific extension (%v...)
3738	ok 264 # SKIP perl5-specific extension (%v...)
3739	ok 265 # SKIP perl5-specific extension (%v...)
3740	ok 266 # SKIP perl5-specific extension (%v...)
3741	ok 267 # SKIP perl5-specific extension (%v...)
3742	ok 268 # SKIP perl5-specific extension (%v...)
3743	ok 269 # SKIP perl5-specific extension (%v...)
3744	ok 270 # SKIP perl5-specific extension (%v...)
3745	ok 271 # SKIP perl5-specific extension (%v...)
3746	ok 272 # SKIP perl5-specific extension (%v...)
3747	ok 273 # SKIP perl5-specific extension (%v...)
3748	ok 274 # SKIP perl5-specific extension (%v...)
3749	ok 275 # SKIP perl5-specific extension (%v...)
3750	ok 276 # SKIP perl5-specific extension (%v...)
3751	ok 277 # SKIP perl5-specific extension (%v...)
3752	ok 278 # SKIP perl5-specific extension (%v...)
3753	ok 279 # SKIP perl5-specific extension (%v...)
3754	ok 280 # SKIP perl5-specific extension (%v...)
3755	ok 281 # SKIP perl5-specific extension (%v...)
3756	ok 282 # SKIP perl5-specific extension (%v...)
3757	ok 283 # SKIP perl5-specific extension (%v...)
3758	ok 284 # SKIP perl5-specific extension (%v...)
3759	ok 285 # SKIP perl5-specific extension (%v...)
3760	ok 286 # SKIP perl5-specific extension (%v...)
3761	ok 287 # SKIP perl5-specific extension (%v...)
3762	ok 288 # SKIP perl5-specific extension (%v...)
3763	ok 289 # SKIP perl5-specific extension (%v...)
3764	ok 290 # SKIP perl5-specific extension (%v...)
3765	ok 291 # SKIP perl5-specific extension (%v...)
3766	ok 292 # SKIP perl5-specific extension (%v...)
3767	ok 293 # SKIP perl5-specific extension (%v...)
3768	ok 294 # SKIP perl5-specific extension (%v...)
3769	ok 295 # SKIP perl5-specific extension (%v...)
3770	ok 296 # SKIP perl5-specific extension (%v...)
3771	ok 297 # SKIP perl5-specific extension (%v...)
3772	ok 298 # SKIP perl5-specific extension (%v...)
3773	ok 300 # SKIP harness needs support for * modifier
3774	not ok 304 # TODO [%#b] actual: >0b0<
3775	not ok 305 # TODO [%#o] actual: >00<
3776	not ok 306 # TODO [%#x] actual: >0x0<
3777	ok 307 # SKIP perl5-specific extension (%v...)
3778	ok 308 # SKIP perl5-specific extension (%v...)
3779	ok
3780	t/op/sprintf2..........................ok
3781	t/op/string............................
3782	ok 103 # SKIP Pending rework of creating non-ascii literals
3783	ok 104 # SKIP Pending rework of creating non-ascii literals
3784	ok 118 # SKIP Pending reimplementation of find_encoding
3785	ok 119 # SKIP no more visible encoding
3786	ok 137 # SKIP No unicode yet
3787	ok 139 # SKIP no more transcode
3788	ok 140 # SKIP no more chartype
3789	ok
3790	t/op/string_cclass.....................
3791	ok 7 # SKIP unicode support unavailable
3792	ok 8 # SKIP unicode support unavailable
3793	ok 9 # SKIP unicode support unavailable
3794	ok
3795	t/op/string_cs.........................
3796	ok 31 # SKIP no ICU lib
3797	ok 32 # SKIP no ICU lib
3798	ok 33 # SKIP no ICU lib
3799	ok 34 # SKIP no ICU lib
3800	ok 35 # SKIP no ICU lib
3801	ok 36 # SKIP no ICU lib
3802	ok 37 # SKIP no ICU lib
3803	ok 38 # SKIP no ICU lib
3804	ok 39 # SKIP no ICU lib
3805	ok 40 # SKIP no ICU lib
3806	ok 41 # SKIP no ICU lib
3807	ok 42 # SKIP no ICU lib
3808	ok 43 # SKIP no ICU lib
3809	ok 44 # SKIP no ICU lib
3810	ok 45 # SKIP no ICU lib
3811	ok 46 # SKIP no ICU lib
3812	ok
3813	t/op/string_mem........................ok
3814	t/op/stringu...........................
3815	ok 20 # SKIP no ICU lib
3816	ok 21 # SKIP no ICU lib
3817	ok 22 # SKIP no ICU lib
3818	ok 25 # SKIP Tests seem to fail on big endian machines with icu
3819	ok 26 # SKIP Tests seem to fail on big endian machines with icu
3820	not ok 27 - UTF-8 and Unicode literals # TODO TT #24
3821	ok
3822	t/op/sysinfo...........................
3823	not ok 11 - sysinfo OS version string # TODO Not Currently Implemented
3824	not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented
3825	ok 13 # SKIP Requires a lot of work to find out the correct answer
3826	ok 14 # SKIP Testing only in some known platforms
3827	ok
3828	t/op/time..............................ok
3829	t/op/trans.............................ok
3830	t/pmc/addrregistry.....................ok
3831	t/pmc/array............................
3832	not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken
3833	ok
3834	t/pmc/bigint...........................
3835	1..0 # Skip No BigInt Lib configured
3836	skipped: No BigInt Lib configured
3837	t/pmc/bignum...........................
3838	1..0 # Skip No BigNum PMC enabled
3839	skipped: No BigNum PMC enabled
3840	t/pmc/boolean..........................ok
3841	t/pmc/bound_nci........................ok
3842	t/pmc/callsignature....................ok
3843	t/pmc/capture..........................ok
3844	t/pmc/class............................
3845	not ok 28 # TODO add_method() invoking method added to class works
3846	ok
3847	t/pmc/codestring.......................ok
3848	t/pmc/complex..........................
3849	ok 58 # SKIP div by zero not caught
3850	ok 59 # SKIP div by zero not caught
3851	ok 60 # SKIP div by zero not caught
3852	ok 86 # SKIP instantiate n/y
3853	ok 87 # SKIP instantiate n/y
3854	ok 88 # SKIP instantiate n/y
3855	ok 89 # SKIP instantiate n/y
3856	ok 126 # SKIP inf is not platform-independent
3857	ok 465 # SKIP add using subclass of Complex - RT #59630
3858	ok 466 # SKIP add using subclass of Complex - RT #59630
3859	ok 467 # SKIP add using subclass of Complex - RT #59630
3860	ok
3861	t/pmc/config...........................ok
3862	t/pmc/continuation.....................ok
3863	t/pmc/coroutine........................
3864	not ok 9 - Call an exited coroutine # TODO goes one iteration too far.
3865	ok
3866	t/pmc/cpointer.........................ok
3867	t/pmc/default..........................
3868	not ok 1 - new # TODO not implemeted
3869	ok
3870	t/pmc/env..............................ok
3871	t/pmc/eval.............................ok
3872	t/pmc/eventhandler.....................ok
3873	t/pmc/exception........................
3874	not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans
3875	not ok 25 - pushaction: error while handling error # TODO runloop shenanigans
3876	not ok 27 - invoke handler in calling sub # TODO deprecate rethrow
3877	not ok 30 - catch ex from C-level MULTI function # TODO broken
3878	ok
3879	t/pmc/exceptionhandler.................ok
3880	t/pmc/exporter.........................ok
3881	t/pmc/file.............................ok
3882	t/pmc/filehandle.......................
3883	ok 3 # SKIP no asynch calls yet
3884	not ok 8 - record_separator # TODO not yet implemented
3885	ok
3886	t/pmc/fixedbooleanarray................ok
3887	t/pmc/fixedfloatarray..................ok
3888	t/pmc/fixedintegerarray................ok
3889	t/pmc/fixedpmcarray....................ok
3890	t/pmc/fixedstringarray.................ok
3891	t/pmc/float............................ok
3892	t/pmc/freeze...........................ok
3893	t/pmc/globals..........................ok
3894	t/pmc/hash.............................ok
3895	t/pmc/integer..........................ok
3896	t/pmc/io...............................
3897	not ok 1 - IO on some invalid types # TODO IO on some invalid types
3898	ok 8 # SKIP clone not finished yet
3899	not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433
3900	not ok 40 - string read/write handle # TODO no stringhandle yet
3901	ok
3902	t/pmc/io_iterator......................
3903	not ok 1 - new # TODO not yet implemented
3904	not ok 2 - shift # TODO not yet implemented
3905	not ok 3 - get_bool (vtable) # TODO not yet implemented
3906	ok
3907	t/pmc/io_status........................
3908	not ok 1 - new # TODO not yet implemented
3909	not ok 2 - get_integer (vtable) # TODO not yet implemented
3910	not ok 3 - get_bool (vtable) # TODO not yet implemented
3911	not ok 4 - return # TODO not yet implemented
3912	not ok 5 - error # TODO not yet implemented
3913	not ok 6 - throw # TODO not yet implemented
3914	ok
3915	t/pmc/iterator.........................
3916	ok 13 # SKIP N/Y: length of rest of array
3917	not ok 16 - adding keys during iteration # TODO adding keys during iteration
3918	not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points'
3919	ok
3920	t/pmc/key..............................
3921	not ok 10 # TODO register and non-register string keys should be COW (RT #60128)
3922	ok
3923	t/pmc/lexinfo..........................ok
3924	t/pmc/lexpad...........................ok
3925	t/pmc/managedstruct....................ok
3926	t/pmc/multidispatch....................
3927	not ok 22 - MMD on PMC types - Any # TODO RT #41374
3928	not ok 25 - add as method - inherited # TODO RT #41374
3929	not ok 32 - use a core func for an object # TODO RT #59628
3930	ok
3931	t/pmc/multisub.........................ok
3932	t/pmc/namespace........................
3933	not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17
3934	ok
3935	t/pmc/nci..............................ok
3936	t/pmc/null.............................ok
3937	t/pmc/object-meths.....................
3938	ok 14 # SKIP currently broken
3939	ok 25 # SKIP no bound NCI method
3940	ok
3941	t/pmc/object-mro.......................ok
3942	t/pmc/object...........................ok
3943	t/pmc/objects..........................ok
3944	t/pmc/orderedhash......................ok
3945	t/pmc/os...............................ok
3946	t/pmc/packfile.........................ok
3947	t/pmc/packfileconstanttable............
3948	not ok 3 - get_type, get_*_keyed_int # TODO See TT #385.
3949	ok
3950	t/pmc/packfiledirectory................ok
3951	t/pmc/packfilefixupentry...............ok
3952	t/pmc/packfilefixuptable...............ok
3953	t/pmc/packfilerawsegment...............ok
3954	t/pmc/packfilesegment..................ok
3955	t/pmc/parrotclass......................ok
3956	t/pmc/parrotinterpreter................ok
3957	t/pmc/parrotio.........................
3958	not ok 2 - open and close - synchronous # TODO not yet implemented
3959	ok 3 # SKIP no asynch calls yet
3960	not ok 4 - print, read, and readline - synchronous # TODO not yet implemented
3961	not ok 5 - record_separator # TODO not yet implemented
3962	not ok 6 - buffer_type # TODO not yet implemented
3963	ok
3964	t/pmc/parrotlibrary....................ok
3965	t/pmc/parrotobject.....................ok
3966	t/pmc/parrotrunningthread..............ok
3967	t/pmc/parrotthread.....................ok
3968	t/pmc/pccmethod_test...................ok
3969	t/pmc/pmc..............................ok
3970	t/pmc/pmcproxy.........................ok
3971	t/pmc/pointer..........................ok
3972	t/pmc/prop.............................ok
3973	t/pmc/random...........................ok
3974	t/pmc/ref..............................ok
3975	t/pmc/resizablebooleanarray............ok
3976	t/pmc/resizablefloatarray..............ok
3977	t/pmc/resizableintegerarray............ok
3978	t/pmc/resizablepmcarray................ok
3979	t/pmc/resizablestringarray.............ok
3980	t/pmc/retcontinuation..................ok
3981	t/pmc/ro...............................
3982	not ok 8 - ResizablePMCArray -- Recursive # TODO 1
3983	ok
3984	t/pmc/role.............................ok
3985	t/pmc/scalar...........................
3986	ok 1 # SKIP doesn't work yet
3987	ok
3988	t/pmc/scheduler........................ok
3989	t/pmc/schedulermessage.................ok
3990	t/pmc/sharedref........................ok
3991	t/pmc/signal...........................
3992	1..0 # Skip Signals currently disabled
3993	skipped: Signals currently disabled
3994	t/pmc/slice............................
3995	not ok 2 - bug with slice bits # TODO parser
3996	ok
3997	t/pmc/string...........................ok
3998	t/pmc/stringhandle.....................
3999	ok 3 # SKIP no asynch calls yet
4000	not ok 9 - record_separator # TODO not yet implemented
4001	ok
4002	t/pmc/sub..............................ok
4003	t/pmc/sys..............................ok
4004	t/pmc/task.............................ok
4005	t/pmc/threads..........................
4006	not ok 11 - CLONE_CODE \| CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511
4007	not ok 15 - CLONE_CODE\|CLONE_GLOBALS\|CLONE_HLL\|CLONE_LIBRARIES # TODO RT #41373
4008	ok
4009	t/pmc/timer............................ok
4010	t/pmc/undef............................ok
4011	t/pmc/unmanagedstruct..................ok
4012	t/oo/attributes........................ok
4013	t/oo/composition.......................ok
4014	t/oo/inheritance.......................ok
4015	t/oo/isa...............................ok
4016	t/oo/metamodel.........................
4017	not ok 6 # TODO tail attribute has a type
4018	not ok 12 # TODO new opcode makes working objects
4019	ok
4020	t/oo/methods...........................ok
4021	t/oo/mro-c3............................ok
4022	t/oo/names.............................ok
4023	t/oo/new...............................ok
4024	t/oo/ops...............................ok
4025	t/oo/proxy.............................ok
4026	t/oo/subclass..........................ok
4027	t/oo/vtableoverride....................ok
4028	t/native_pbc/header....................
4029	1..0 # Skip pending robust testing strategy, TT #357
4030	skipped: pending robust testing strategy, TT #357
4031	t/native_pbc/integer...................
4032	1..0 # Skip pending robust testing strategy, TT #357
4033	skipped: pending robust testing strategy, TT #357
4034	t/native_pbc/number....................
4035	1..0 # Skip pending robust testing strategy, TT #357
4036	skipped: pending robust testing strategy, TT #357
4037	t/native_pbc/string....................
4038	1..0 # Skip pending robust testing strategy, TT #357
4039	skipped: pending robust testing strategy, TT #357
4040	t/dynpmc/dynlexpad.....................
4041	not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads
4042	ok
4043	t/dynpmc/foo...........................
4044	ok 6 # SKIP No BigInt Lib configured
4045	ok
4046	t/dynpmc/gdbmhash......................
4047	1..0 # Skip No gdbm library available
4048	skipped: No gdbm library available
4049	t/dynpmc/md2...........................ok
4050	t/dynpmc/md4...........................ok
4051	t/dynpmc/md5...........................ok
4052	t/dynpmc/pair..........................ok
4053	t/dynpmc/rational......................ok
4054	t/dynpmc/ripemd160.....................ok
4055	t/dynpmc/rotest........................ok
4056	t/dynpmc/sha...........................ok
4057	t/dynpmc/sha1..........................ok
4058	t/dynpmc/sha256........................
4059	1..0 # Skip Too old library
4060	skipped: Too old library
4061	t/dynpmc/sha512........................
4062	1..0 # Skip Too old library
4063	skipped: Too old library
4064	t/dynpmc/subclass_with_pir_method......
4065	not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces
4066	not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces
4067	ok
4068	t/dynpmc/subproxy......................ok
4069	t/dynoplibs/dan........................ok
4070	t/dynoplibs/myops......................
4071	ok 6 # SKIP dynops weird in CGP with events
4072	ok 7 # SKIP dynops weird in CGP with events
4073	ok
4074	t/compilers/pct/complete_workflow......ok
4075	t/compilers/pct/past...................ok
4076	t/compilers/pct/pct_hllcompiler........ok
4077	t/compilers/pct/post...................ok
4078	t/compilers/pge/00-basic...............ok
4079	t/compilers/pge/02-match...............ok
4080	t/compilers/pge/03-optable.............ok
4081	t/compilers/pge/04-compile.............ok
4082	t/compilers/pge/06-grammar.............ok
4083	t/compilers/pge/pge-hs.................ok
4084	t/compilers/pge/pge....................ok
4085	t/compilers/pge/pge_examples...........ok
4086	t/compilers/pge/pge_globs..............ok
4087	t/compilers/pge/pge_text...............ok
4088	t/compilers/pge/pge_util...............ok
4089	t/compilers/pge/p5regex/p5rx...........
4090	not ok 116 # TODO [re_tests:116] character class in enumeration
4091	not ok 119 # TODO [re_tests:119] character class in enumeration
4092	not ok 120 # TODO [re_tests:120] character class in enumeration
4093	not ok 123 # TODO [re_tests:123] character class in enumeration
4094	not ok 124 # TODO [re_tests:124] character class in enumeration
4095	not ok 127 # TODO [re_tests:127] character class in enumeration
4096	ok 138 # SKIP [re_tests:138] parser bug
4097	ok 139 # SKIP [re_tests:139] broken col 4?
4098	ok 143 # SKIP [re_tests:143] bug or error
4099	ok 144 # SKIP [re_tests:144] bug or error
4100	ok 148 # SKIP [re_tests:148] bug or error
4101	ok 149 # SKIP [re_tests:149] bug or error
4102	ok 155 # SKIP [re_tests:155] bug or error
4103	ok 167 # SKIP [re_tests:167] bug or error
4104	not ok 234 # TODO [re_tests:234] unknown reason
4105	not ok 235 # TODO [re_tests:235] unknown reason
4106	not ok 236 # TODO [re_tests:236] unknown reason
4107	not ok 246 # TODO [re_tests:246] unknown reason
4108	not ok 247 # TODO [re_tests:247] unknown reason
4109	ok 248 # SKIP [re_tests:248] bug or error
4110	ok 249 # SKIP [re_tests:249] bug or error
4111	ok 252 # SKIP [re_tests:252] bug or error
4112	not ok 254 # TODO [re_tests:254] unknown reason
4113	not ok 256 # TODO [re_tests:256] unknown reason
4114	not ok 257 # TODO [re_tests:257] unknown reason
4115	ok 264 # SKIP [re_tests:264] trailing modifiers
4116	ok 265 # SKIP [re_tests:265] trailing modifiers
4117	ok 266 # SKIP [re_tests:266] trailing modifiers
4118	ok 267 # SKIP [re_tests:267] trailing modifiers
4119	ok 268 # SKIP [re_tests:268] trailing modifiers
4120	ok 269 # SKIP [re_tests:269] trailing modifiers
4121	ok 270 # SKIP [re_tests:270] trailing modifiers
4122	ok 271 # SKIP [re_tests:271] trailing modifiers
4123	ok 272 # SKIP [re_tests:272] trailing modifiers
4124	ok 273 # SKIP [re_tests:273] trailing modifiers
4125	ok 274 # SKIP [re_tests:274] trailing modifiers
4126	ok 275 # SKIP [re_tests:275] trailing modifiers
4127	ok 276 # SKIP [re_tests:276] trailing modifiers
4128	ok 277 # SKIP [re_tests:277] trailing modifiers
4129	ok 278 # SKIP [re_tests:278] trailing modifiers
4130	ok 279 # SKIP [re_tests:279] trailing modifiers
4131	ok 280 # SKIP [re_tests:280] trailing modifiers
4132	ok 281 # SKIP [re_tests:281] trailing modifiers
4133	ok 282 # SKIP [re_tests:282] trailing modifiers
4134	ok 283 # SKIP [re_tests:283] trailing modifiers
4135	ok 284 # SKIP [re_tests:284] trailing modifiers
4136	ok 285 # SKIP [re_tests:285] trailing modifiers
4137	ok 286 # SKIP [re_tests:286] trailing modifiers
4138	ok 287 # SKIP [re_tests:287] trailing modifiers
4139	ok 288 # SKIP [re_tests:288] trailing modifiers
4140	ok 289 # SKIP [re_tests:289] trailing modifiers
4141	ok 290 # SKIP [re_tests:290] trailing modifiers
4142	ok 291 # SKIP [re_tests:291] trailing modifiers
4143	ok 292 # SKIP [re_tests:292] trailing modifiers
4144	ok 293 # SKIP [re_tests:293] trailing modifiers
4145	ok 294 # SKIP [re_tests:294] trailing modifiers
4146	ok 295 # SKIP [re_tests:295] trailing modifiers
4147	ok 296 # SKIP [re_tests:296] trailing modifiers
4148	ok 297 # SKIP [re_tests:297] trailing modifiers
4149	ok 298 # SKIP [re_tests:298] trailing modifiers
4150	ok 299 # SKIP [re_tests:299] trailing modifiers
4151	ok 300 # SKIP [re_tests:300] trailing modifiers
4152	ok 301 # SKIP [re_tests:301] trailing modifiers
4153	ok 302 # SKIP [re_tests:302] trailing modifiers
4154	ok 303 # SKIP [re_tests:303] trailing modifiers
4155	ok 304 # SKIP [re_tests:304] trailing modifiers
4156	ok 305 # SKIP [re_tests:305] trailing modifiers
4157	ok 306 # SKIP [re_tests:306] trailing modifiers
4158	ok 307 # SKIP [re_tests:307] trailing modifiers
4159	ok 308 # SKIP [re_tests:308] bug or error
4160	ok 309 # SKIP [re_tests:309] bug or error
4161	ok 310 # SKIP [re_tests:310] bug or error
4162	ok 311 # SKIP [re_tests:311] trailing modifiers
4163	ok 312 # SKIP [re_tests:312] trailing modifiers
4164	ok 313 # SKIP [re_tests:313] trailing modifiers
4165	ok 314 # SKIP [re_tests:314] trailing modifiers
4166	ok 315 # SKIP [re_tests:315] trailing modifiers
4167	ok 316 # SKIP [re_tests:316] trailing modifiers
4168	ok 317 # SKIP [re_tests:317] trailing modifiers
4169	ok 318 # SKIP [re_tests:318] trailing modifiers
4170	ok 319 # SKIP [re_tests:319] trailing modifiers
4171	ok 320 # SKIP [re_tests:320] trailing modifiers
4172	ok 321 # SKIP [re_tests:321] trailing modifiers
4173	ok 322 # SKIP [re_tests:322] bug or error
4174	ok 323 # SKIP [re_tests:323] bug or error
4175	ok 324 # SKIP [re_tests:324] trailing modifiers
4176	ok 325 # SKIP [re_tests:325] bug or error
4177	ok 326 # SKIP [re_tests:326] trailing modifiers
4178	ok 327 # SKIP [re_tests:327] trailing modifiers
4179	ok 328 # SKIP [re_tests:328] trailing modifiers
4180	ok 329 # SKIP [re_tests:329] trailing modifiers
4181	ok 330 # SKIP [re_tests:330] bug or error
4182	ok 331 # SKIP [re_tests:331] bug or error
4183	ok 332 # SKIP [re_tests:332] trailing modifiers
4184	ok 333 # SKIP [re_tests:333] trailing modifiers
4185	ok 334 # SKIP [re_tests:334] trailing modifiers
4186	ok 335 # SKIP [re_tests:335] trailing modifiers
4187	ok 336 # SKIP [re_tests:336] bug or error
4188	ok 337 # SKIP [re_tests:337] trailing modifiers
4189	ok 338 # SKIP [re_tests:338] trailing modifiers
4190	ok 339 # SKIP [re_tests:339] trailing modifiers
4191	ok 340 # SKIP [re_tests:340] trailing modifiers
4192	ok 341 # SKIP [re_tests:341] trailing modifiers
4193	ok 342 # SKIP [re_tests:342] trailing modifiers
4194	ok 343 # SKIP [re_tests:343] trailing modifiers
4195	ok 344 # SKIP [re_tests:344] trailing modifiers
4196	ok 345 # SKIP [re_tests:345] trailing modifiers
4197	ok 346 # SKIP [re_tests:346] trailing modifiers
4198	ok 347 # SKIP [re_tests:347] bug or error
4199	ok 348 # SKIP [re_tests:348] trailing modifiers
4200	ok 349 # SKIP [re_tests:349] trailing modifiers
4201	ok 350 # SKIP [re_tests:350] trailing modifiers
4202	ok 351 # SKIP [re_tests:351] trailing modifiers
4203	ok 352 # SKIP [re_tests:352] trailing modifiers
4204	ok 353 # SKIP [re_tests:353] trailing modifiers
4205	ok 354 # SKIP [re_tests:354] trailing modifiers
4206	ok 355 # SKIP [re_tests:355] trailing modifiers
4207	ok 356 # SKIP [re_tests:356] trailing modifiers
4208	ok 357 # SKIP [re_tests:357] trailing modifiers
4209	ok 358 # SKIP [re_tests:358] trailing modifiers
4210	ok 359 # SKIP [re_tests:359] trailing modifiers
4211	ok 360 # SKIP [re_tests:360] trailing modifiers
4212	ok 361 # SKIP [re_tests:361] trailing modifiers
4213	ok 362 # SKIP [re_tests:362] trailing modifiers
4214	ok 363 # SKIP [re_tests:363] trailing modifiers
4215	ok 364 # SKIP [re_tests:364] trailing modifiers
4216	ok 365 # SKIP [re_tests:365] trailing modifiers
4217	ok 366 # SKIP [re_tests:366] trailing modifiers
4218	ok 367 # SKIP [re_tests:367] trailing modifiers
4219	ok 368 # SKIP [re_tests:368] trailing modifiers
4220	ok 369 # SKIP [re_tests:369] trailing modifiers
4221	ok 370 # SKIP [re_tests:370] trailing modifiers
4222	ok 371 # SKIP [re_tests:371] trailing modifiers
4223	ok 372 # SKIP [re_tests:372] trailing modifiers
4224	ok 373 # SKIP [re_tests:373] trailing modifiers
4225	ok 374 # SKIP [re_tests:374] trailing modifiers
4226	ok 375 # SKIP [re_tests:375] trailing modifiers
4227	ok 376 # SKIP [re_tests:376] trailing modifiers
4228	ok 377 # SKIP [re_tests:377] trailing modifiers
4229	ok 378 # SKIP [re_tests:378] trailing modifiers
4230	ok 379 # SKIP [re_tests:379] trailing modifiers
4231	ok 380 # SKIP [re_tests:380] trailing modifiers
4232	ok 381 # SKIP [re_tests:381] trailing modifiers
4233	ok 382 # SKIP [re_tests:382] trailing modifiers
4234	ok 383 # SKIP [re_tests:383] trailing modifiers
4235	ok 384 # SKIP [re_tests:384] trailing modifiers
4236	ok 385 # SKIP [re_tests:385] trailing modifiers
4237	ok 386 # SKIP [re_tests:386] trailing modifiers
4238	ok 387 # SKIP [re_tests:387] trailing modifiers
4239	ok 388 # SKIP [re_tests:388] trailing modifiers
4240	ok 389 # SKIP [re_tests:389] trailing modifiers
4241	ok 390 # SKIP [re_tests:390] trailing modifiers
4242	ok 391 # SKIP [re_tests:391] trailing modifiers
4243	ok 392 # SKIP [re_tests:392] trailing modifiers
4244	ok 393 # SKIP [re_tests:393] trailing modifiers
4245	ok 394 # SKIP [re_tests:394] trailing modifiers
4246	ok 395 # SKIP [re_tests:395] trailing modifiers
4247	not ok 396 # TODO [re_tests:396] unknown reason
4248	not ok 397 # TODO [re_tests:397] unknown reason
4249	not ok 398 # TODO [re_tests:398] unknown reason
4250	ok 408 # SKIP [re_tests:408] bug or error
4251	not ok 419 # TODO [re_tests:419] unknown reason
4252	not ok 422 # TODO [re_tests:422] unknown reason
4253	not ok 429 # TODO [re_tests:429] unknown reason
4254	not ok 432 # TODO [re_tests:432] unknown reason
4255	not ok 434 # TODO [re_tests:434] unknown reason
4256	not ok 435 # TODO [re_tests:435] unknown reason
4257	ok 436 # SKIP [re_tests:436] bug or error
4258	not ok 439 # TODO [re_tests:439] unknown reason
4259	not ok 446 # TODO [re_tests:446] unknown reason
4260	not ok 447 # TODO [re_tests:447] unknown reason
4261	not ok 448 # TODO [re_tests:448] unknown reason
4262	not ok 449 # TODO [re_tests:449] unknown reason
4263	not ok 452 # TODO [re_tests:452] unknown reason
4264	not ok 453 # TODO [re_tests:453] unknown reason
4265	not ok 454 # TODO [re_tests:454] unknown reason
4266	not ok 455 # TODO [re_tests:455] unknown reason
4267	ok 458 # SKIP [re_tests:458] unknown reason
4268	ok 459 # SKIP [re_tests:459] unknown reason
4269	ok 460 # SKIP [re_tests:460] unknown reason
4270	ok 461 # SKIP [re_tests:461] unknown reason
4271	ok 462 # SKIP [re_tests:462] unknown reason
4272	ok 463 # SKIP [re_tests:463] unknown reason
4273	ok 464 # SKIP [re_tests:464] unknown reason
4274	ok 465 # SKIP [re_tests:465] unknown reason
4275	ok 466 # SKIP [re_tests:466] unknown reason
4276	ok 467 # SKIP [re_tests:467] unknown reason
4277	ok 468 # SKIP [re_tests:468] unknown reason
4278	ok 469 # SKIP [re_tests:469] unknown reason
4279	ok 470 # SKIP [re_tests:470] unknown reason
4280	ok 471 # SKIP [re_tests:471] unknown reason
4281	ok 472 # SKIP [re_tests:472] unknown reason
4282	ok 473 # SKIP [re_tests:473] unknown reason
4283	ok 474 # SKIP [re_tests:474] unknown reason
4284	ok 475 # SKIP [re_tests:475] unknown reason
4285	ok 476 # SKIP [re_tests:476] unknown reason
4286	ok 477 # SKIP [re_tests:477] unknown reason
4287	ok 478 # SKIP [re_tests:478] unknown reason
4288	ok 479 # SKIP [re_tests:479] unknown reason
4289	ok 480 # SKIP [re_tests:480] unknown reason
4290	ok 483 # SKIP [re_tests:483]
4291	ok 484 # SKIP [re_tests:484]
4292	ok 487 # SKIP [re_tests:487] bug or error
4293	ok 488 # SKIP [re_tests:488] bug or error
4294	ok 489 # SKIP [re_tests:489] bug or error
4295	ok 490 # SKIP [re_tests:490] bug or error
4296	ok 491 # SKIP [re_tests:491] kills a parrot
4297	ok 492 # SKIP [re_tests:492] bug or error
4298	ok 493 # SKIP [re_tests:493] kills a parrot
4299	not ok 495 # TODO [re_tests:495] unknown reason
4300	ok 496 # SKIP [re_tests:496]
4301	not ok 498 # TODO [re_tests:498] unknown reason
4302	not ok 500 # TODO [re_tests:500] unknown reason
4303	not ok 501 # TODO [re_tests:501] unknown reason
4304	ok 502 # SKIP [re_tests:502] unknown reason
4305	not ok 503 # TODO [re_tests:503] unknown reason
4306	not ok 504 # TODO [re_tests:504] unknown reason
4307	not ok 505 # TODO [re_tests:505] unknown reason
4308	not ok 506 # TODO [re_tests:506] unknown reason
4309	not ok 507 # TODO [re_tests:507] unknown reason
4310	not ok 508 # TODO [re_tests:508] unknown reason
4311	not ok 509 # TODO [re_tests:509] unknown reason
4312	not ok 510 # TODO [re_tests:510] unknown reason
4313	not ok 511 # TODO [re_tests:511] unknown reason
4314	not ok 512 # TODO [re_tests:512] unknown reason
4315	not ok 515 # TODO [re_tests:515] unknown reason
4316	not ok 521 # TODO [re_tests:521] unknown reason
4317	not ok 522 # TODO [re_tests:522] unknown reason
4318	not ok 523 # TODO [re_tests:523] unknown reason
4319	not ok 524 # TODO [re_tests:524] unknown reason
4320	not ok 527 # TODO [re_tests:527] unknown reason
4321	not ok 528 # TODO [re_tests:528] unknown reason
4322	ok 531 # SKIP [re_tests:531] bug or error
4323	ok 532 # SKIP [re_tests:532] bug or error
4324	not ok 535 # TODO [re_tests:535] unknown reason
4325	not ok 536 # TODO [re_tests:536] unknown reason
4326	not ok 539 # TODO [re_tests:539] unknown reason
4327	not ok 540 # TODO [re_tests:540] unknown reason
4328	not ok 541 # TODO [re_tests:541] unknown reason
4329	not ok 544 # TODO [re_tests:544] unknown reason
4330	not ok 545 # TODO [re_tests:545] unknown reason
4331	ok 556 # SKIP [re_tests:556] kills a parrot
4332	ok 557 # SKIP [re_tests:557] kills a parrot
4333	not ok 559 # TODO [re_tests:559] unknown reason
4334	ok 563 # SKIP [re_tests:563] bug or error
4335	ok 564 # SKIP [re_tests:564] bug or error
4336	ok 566 # SKIP [re_tests:566] bug or error
4337	ok 568 # SKIP [re_tests:568] kills a parrot
4338	ok 569 # SKIP [re_tests:569] kills a parrot
4339	ok 570 # SKIP [re_tests:570] kills a parrot
4340	ok 571 # SKIP [re_tests:571] kills a parrot
4341	ok 572 # SKIP [re_tests:572] kills a parrot
4342	ok 573 # SKIP [re_tests:573] kills a parrot
4343	ok 574 # SKIP [re_tests:574] kills a parrot
4344	ok 575 # SKIP [re_tests:575] kills a parrot
4345	ok 576 # SKIP [re_tests:576] kills a parrot
4346	ok 577 # SKIP [re_tests:577] kills a parrot
4347	ok 578 # SKIP [re_tests:578] kills a parrot
4348	ok 579 # SKIP [re_tests:579] kills a parrot
4349	ok 580 # SKIP [re_tests:580] kills a parrot
4350	ok 581 # SKIP [re_tests:581] kills a parrot
4351	ok 582 # SKIP [re_tests:582] kills a parrot
4352	ok 583 # SKIP [re_tests:583] kills a parrot
4353	ok 584 # SKIP [re_tests:584] kills a parrot
4354	ok 585 # SKIP [re_tests:585] kills a parrot
4355	ok 586 # SKIP [re_tests:586] kills a parrot
4356	ok 587 # SKIP [re_tests:587] kills a parrot
4357	ok 588 # SKIP [re_tests:588] kills a parrot
4358	ok 589 # SKIP [re_tests:589] kills a parrot
4359	ok 590 # SKIP [re_tests:590] kills a parrot
4360	ok 591 # SKIP [re_tests:591] kills a parrot
4361	ok 592 # SKIP [re_tests:592] kills a parrot
4362	ok 593 # SKIP [re_tests:593] bug or error
4363	ok 594 # SKIP [re_tests:594] bug or error
4364	not ok 595 # TODO [re_tests:595] unknown reason
4365	not ok 596 # TODO [re_tests:596] unknown reason
4366	ok 597 # SKIP [re_tests:597] unknown reason
4367	ok 598 # SKIP [re_tests:598] bug or error
4368	ok 599 # SKIP [re_tests:599] bug or error
4369	not ok 600 # TODO [re_tests:600] unknown reason
4370	not ok 601 # TODO [re_tests:601] unknown reason
4371	not ok 603 # TODO [re_tests:603] unknown reason
4372	not ok 604 # TODO [re_tests:604] unknown reason
4373	not ok 606 # TODO [re_tests:606] unknown reason
4374	not ok 607 # TODO [re_tests:607] unknown reason
4375	ok 609 # SKIP [re_tests:609] unknown reason
4376	ok 610 # SKIP [re_tests:610] unknown reason
4377	ok 611 # SKIP [re_tests:611] unknown reason
4378	ok 612 # SKIP [re_tests:612] unknown reason
4379	ok 613 # SKIP [re_tests:613] unknown reason
4380	ok 614 # SKIP [re_tests:614] unknown reason
4381	ok 615 # SKIP [re_tests:615] unknown reason
4382	ok 616 # SKIP [re_tests:616] unknown reason
4383	ok 617 # SKIP [re_tests:617] unknown reason
4384	not ok 621 # TODO [re_tests:621] unknown reason
4385	not ok 623 # TODO [re_tests:623] unknown reason
4386	not ok 624 # TODO [re_tests:624] unknown reason
4387	not ok 625 # TODO [re_tests:625] unknown reason
4388	ok 627 # SKIP [re_tests:627] unknown reason
4389	ok 628 # SKIP [re_tests:628] unknown reason
4390	ok 629 # SKIP [re_tests:629] unknown reason
4391	ok 630 # SKIP [re_tests:630] unknown reason
4392	ok 631 # SKIP [re_tests:631] unknown reason
4393	ok 632 # SKIP [re_tests:632] unknown reason
4394	ok 633 # SKIP [re_tests:633] unknown reason
4395	ok 634 # SKIP [re_tests:634] unknown reason
4396	ok 635 # SKIP [re_tests:635] unknown reason
4397	not ok 639 # TODO [re_tests:639] unknown reason
4398	not ok 641 # TODO [re_tests:641] unknown reason
4399	not ok 642 # TODO [re_tests:642] unknown reason
4400	not ok 643 # TODO [re_tests:643] unknown reason
4401	ok 645 # SKIP [re_tests:645] unknown reason
4402	ok 646 # SKIP [re_tests:646] unknown reason
4403	ok 647 # SKIP [re_tests:647] unknown reason
4404	ok 648 # SKIP [re_tests:648] unknown reason
4405	ok 649 # SKIP [re_tests:649] unknown reason
4406	ok 650 # SKIP [re_tests:650] unknown reason
4407	ok 651 # SKIP [re_tests:651] unknown reason
4408	ok 652 # SKIP [re_tests:652] unknown reason
4409	ok 653 # SKIP [re_tests:653] unknown reason
4410	ok 663 # SKIP [re_tests:663] unknown reason
4411	ok 664 # SKIP [re_tests:664] unknown reason
4412	ok 665 # SKIP [re_tests:665] unknown reason
4413	ok 666 # SKIP [re_tests:666] unknown reason
4414	ok 667 # SKIP [re_tests:667] unknown reason
4415	ok 668 # SKIP [re_tests:668] unknown reason
4416	ok 669 # SKIP [re_tests:669] unknown reason
4417	ok 670 # SKIP [re_tests:670] unknown reason
4418	ok 671 # SKIP [re_tests:671] unknown reason
4419	ok 681 # SKIP [re_tests:681] unknown reason
4420	ok 682 # SKIP [re_tests:682] unknown reason
4421	ok 683 # SKIP [re_tests:683] unknown reason
4422	ok 684 # SKIP [re_tests:684] unknown reason
4423	ok 685 # SKIP [re_tests:685] unknown reason
4424	ok 686 # SKIP [re_tests:686] unknown reason
4425	ok 687 # SKIP [re_tests:687] unknown reason
4426	ok 688 # SKIP [re_tests:688] unknown reason
4427	ok 689 # SKIP [re_tests:689] unknown reason
4428	not ok 693 # TODO [re_tests:693] unknown reason
4429	not ok 695 # TODO [re_tests:695] unknown reason
4430	not ok 696 # TODO [re_tests:696] unknown reason
4431	not ok 697 # TODO [re_tests:697] unknown reason
4432	ok 699 # SKIP [re_tests:699] unknown reason
4433	ok 700 # SKIP [re_tests:700] unknown reason
4434	ok 701 # SKIP [re_tests:701] unknown reason
4435	ok 702 # SKIP [re_tests:702] unknown reason
4436	ok 703 # SKIP [re_tests:703] unknown reason
4437	ok 704 # SKIP [re_tests:704] unknown reason
4438	ok 705 # SKIP [re_tests:705] unknown reason
4439	ok 706 # SKIP [re_tests:706] unknown reason
4440	ok 707 # SKIP [re_tests:707] unknown reason
4441	ok 717 # SKIP [re_tests:717] unknown reason
4442	ok 718 # SKIP [re_tests:718] unknown reason
4443	ok 719 # SKIP [re_tests:719] unknown reason
4444	ok 720 # SKIP [re_tests:720] unknown reason
4445	ok 721 # SKIP [re_tests:721] unknown reason
4446	ok 722 # SKIP [re_tests:722] unknown reason
4447	ok 723 # SKIP [re_tests:723] unknown reason
4448	ok 724 # SKIP [re_tests:724] unknown reason
4449	ok 725 # SKIP [re_tests:725] unknown reason
4450	ok 735 # SKIP [re_tests:735] unknown reason
4451	ok 736 # SKIP [re_tests:736] unknown reason
4452	ok 737 # SKIP [re_tests:737] unknown reason
4453	ok 738 # SKIP [re_tests:738] unknown reason
4454	ok 739 # SKIP [re_tests:739] unknown reason
4455	ok 740 # SKIP [re_tests:740] unknown reason
4456	ok 741 # SKIP [re_tests:741] unknown reason
4457	ok 742 # SKIP [re_tests:742] unknown reason
4458	ok 743 # SKIP [re_tests:743] unknown reason
4459	not ok 747 # TODO [re_tests:747] unknown reason
4460	not ok 749 # TODO [re_tests:749] unknown reason
4461	not ok 750 # TODO [re_tests:750] unknown reason
4462	not ok 751 # TODO [re_tests:751] unknown reason
4463	ok 753 # SKIP [re_tests:753] unknown reason
4464	ok 754 # SKIP [re_tests:754] unknown reason
4465	ok 755 # SKIP [re_tests:755] unknown reason
4466	ok 756 # SKIP [re_tests:756] unknown reason
4467	ok 757 # SKIP [re_tests:757] unknown reason
4468	ok 758 # SKIP [re_tests:758] unknown reason
4469	ok 759 # SKIP [re_tests:759] unknown reason
4470	ok 760 # SKIP [re_tests:760] unknown reason
4471	ok 761 # SKIP [re_tests:761] unknown reason
4472	ok 771 # SKIP [re_tests:771] unknown reason
4473	ok 772 # SKIP [re_tests:772] unknown reason
4474	ok 773 # SKIP [re_tests:773] unknown reason
4475	ok 774 # SKIP [re_tests:774] unknown reason
4476	ok 775 # SKIP [re_tests:775] unknown reason
4477	ok 776 # SKIP [re_tests:776] unknown reason
4478	ok 777 # SKIP [re_tests:777] unknown reason
4479	ok 778 # SKIP [re_tests:778] unknown reason
4480	ok 779 # SKIP [re_tests:779] unknown reason
4481	ok 789 # SKIP [re_tests:789] unknown reason
4482	ok 790 # SKIP [re_tests:790] unknown reason
4483	ok 791 # SKIP [re_tests:791] unknown reason
4484	ok 792 # SKIP [re_tests:792] unknown reason
4485	ok 793 # SKIP [re_tests:793] unknown reason
4486	ok 794 # SKIP [re_tests:794] unknown reason
4487	ok 795 # SKIP [re_tests:795] unknown reason
4488	ok 796 # SKIP [re_tests:796] unknown reason
4489	ok 797 # SKIP [re_tests:797] unknown reason
4490	ok 800 # SKIP [re_tests:800]
4491	not ok 801 # TODO [re_tests:801] unknown reason
4492	ok 802 # SKIP [re_tests:802]
4493	ok 803 # SKIP [re_tests:803]
4494	ok 805 # SKIP [re_tests:805]
4495	ok 806 # SKIP [re_tests:806] hangs a parrot
4496	ok 807 # SKIP [re_tests:807] hangs a parrot
4497	ok 808 # SKIP [re_tests:808] hangs a parrot
4498	ok 809 # SKIP [re_tests:809] hangs a parrot
4499	ok 810 # SKIP [re_tests:810] hangs a parrot
4500	ok 811 # SKIP [re_tests:811] hangs a parrot
4501	ok 812 # SKIP [re_tests:812] hangs a parrot
4502	ok 813 # SKIP [re_tests:813] hangs a parrot
4503	ok 814 # SKIP [re_tests:814] hangs a parrot
4504	ok 815 # SKIP [re_tests:815] hangs a parrot
4505	ok 816 # SKIP [re_tests:816] hangs a parrot
4506	ok 817 # SKIP [re_tests:817] hangs a parrot
4507	ok 818 # SKIP [re_tests:818] hangs a parrot
4508	ok 819 # SKIP [re_tests:819] hangs a parrot
4509	ok 820 # SKIP [re_tests:820] hangs a parrot
4510	ok 821 # SKIP [re_tests:821] hangs a parrot
4511	ok 822 # SKIP [re_tests:822] hangs a parrot
4512	ok 823 # SKIP [re_tests:823] hangs a parrot
4513	not ok 827 # TODO [re_tests:827] \d in character class
4514	ok 828 # SKIP [re_tests:828]
4515	ok 829 # SKIP [re_tests:829]
4516	ok 830 # SKIP [re_tests:830]
4517	ok 834 # SKIP [re_tests:834]
4518	ok 835 # SKIP [re_tests:835]
4519	ok 836 # SKIP [re_tests:836]
4520	ok 838 # SKIP [re_tests:838]
4521	not ok 858 # TODO [re_tests:858] unknown reason
4522	ok 859 # SKIP [re_tests:859]
4523	ok 862 # SKIP [re_tests:862]
4524	not ok 865 # TODO [re_tests:865] unknown reason
4525	not ok 866 # TODO [re_tests:866] unknown reason
4526	ok 877 # SKIP [re_tests:877]
4527	ok 879 # SKIP [re_tests:879] [ID 20010811.006]
4528	not ok 881 # TODO [re_tests:881] unknown reason
4529	ok 886 # SKIP [re_tests:886]
4530	not ok 887 # TODO [re_tests:887] unknown reason
4531	not ok 888 # TODO [re_tests:888] unknown reason
4532	not ok 890 # TODO [re_tests:890] unknown reason
4533	not ok 891 # TODO [re_tests:891] unknown reason
4534	not ok 893 # TODO [re_tests:893] unknown reason
4535	not ok 896 # TODO [re_tests:896] unknown reason
4536	not ok 897 # TODO [re_tests:897] unknown reason
4537	not ok 898 # TODO [re_tests:898] unknown reason
4538	not ok 899 # TODO [re_tests:899] unknown reason
4539	not ok 901 # TODO [re_tests:901] greediness/lookbehind
4540	not ok 904 # TODO [re_tests:904] greediness/lookbehind
4541	not ok 905 # TODO [re_tests:905] greediness/lookbehind
4542	not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion
4543	not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion
4544	not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion
4545	not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion
4546	not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion
4547	not ok 915 # TODO [re_tests:915] non-greedy/lookbehind
4548	not ok 916 # TODO [re_tests:916] non-greedy/lookbehind
4549	not ok 918 # TODO [re_tests:918] non-greedy/lookbehind
4550	not ok 921 # TODO [re_tests:921] non-greedy/lookbehind
4551	not ok 922 # TODO [re_tests:922] non-greedy/lookbehind
4552	not ok 923 # TODO [re_tests:923] unmatched bracket
4553	ok 924 # SKIP [re_tests:924]
4554	ok 926 # SKIP [re_tests:926] [perl #18019]
4555	not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171]
4556	not ok 928 # TODO [re_tests:928] reuse captured group
4557	not ok 929 # TODO [re_tests:929] reuse captured group
4558	not ok 930 # TODO [re_tests:930] reuse captured group
4559	not ok 931 # TODO [re_tests:931] reuse captured group
4560	not ok 932 # TODO [re_tests:932] reuse captured group
4561	not ok 933 # TODO [re_tests:933] reuse captured group
4562	not ok 934 # TODO [re_tests:934] reuse captured group
4563	not ok 935 # TODO [re_tests:935] reuse captured group
4564	not ok 936 # TODO [re_tests:936] reuse captured group
4565	not ok 937 # TODO [re_tests:937] reuse captured group
4566	not ok 938 # TODO [re_tests:938] reuse captured group
4567	not ok 939 # TODO [re_tests:939] reuse captured group
4568	not ok 940 # TODO [re_tests:940] reuse captured group
4569	not ok 941 # TODO [re_tests:941] reuse captured group
4570	not ok 942 # TODO [re_tests:942] reuse captured group
4571	ok 944 # SKIP [re_tests:944] unknown reason
4572	ok 945 # SKIP [re_tests:945] unknown reason
4573	ok 957 # SKIP [re_tests:957]
4574	ok 958 # SKIP [re_tests:958]
4575	not ok 959 # TODO [re_tests:959] [perl #34195]
4576	not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion
4577	ok
4578	t/compilers/pge/perl6regex/01-regex....
4579	not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&\|) - parse error
4580	not ok 99 # TODO [rx_metachars:114] null pattern invalid
4581	not ok 386 # TODO [rx_backtrack:4] basic
4582	not ok 427 # TODO [rx_charclass:26] illegal character range
4583	not ok 458 # TODO [rx_charclass:62] literal match (\")
4584	not ok 459 # TODO [rx_charclass:64] literal match (\")
4585	not ok 460 # TODO [rx_charclass:66] literal match with quote
4586	not ok 461 # TODO [rx_charclass:68] literal match with quote
4587	not ok 462 # TODO [rx_charclass:70] literal match with backslash
4588	not ok 463 # TODO [rx_charclass:72] literal match with interpolation
4589	not ok 464 # TODO [rx_charclass:74] literal match with interpolation
4590	not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i)
4591	not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s)
4592	not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s)
4593	not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s)
4594	not ok 709 # TODO [rx_modifiers:131] basic ws match
4595	not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5)
4596	not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth)
4597	not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth)
4598	ok
4599	t/compilers/pge/perl6regex/context.....
4600	not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented
4601	ok
4602	t/compilers/tge/basic..................ok
4603	t/compilers/tge/grammar................
4604	not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug
4605	ok
4606	t/compilers/tge/parser.................ok
4607	t/library/cgi_query_hash...............ok
4608	t/library/coroutine....................ok
4609	t/library/dumper.......................ok
4610	t/library/getopt_obj...................ok
4611	t/library/hllmacros....................ok
4612	t/library/iter.........................ok
4613	t/library/md5..........................ok
4614	t/library/mime_base64..................ok
4615	t/library/mt19937ar....................ok
4616	t/library/p6object.....................
4617	not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) >
4618	ok
4619	t/library/parrotlib....................ok
4620	t/library/pcre.........................
4621	ok 1 # SKIP no pcre-config
4622	ok
4623	t/library/pg...........................
4624	ok 1 # SKIP skipped
4625	ok 2 # SKIP skipped
4626	ok 3 # SKIP skipped
4627	ok 4 # SKIP skipped
4628	ok 5 # SKIP skipped
4629	ok 6 # SKIP skipped
4630	ok 7 # SKIP skipped
4631	ok 8 # SKIP skipped
4632	ok 9 # SKIP skipped
4633	ok 10 # SKIP skipped
4634	ok 11 # SKIP skipped
4635	ok 12 # SKIP skipped
4636	ok 13 # SKIP skipped
4637	ok 14 # SKIP skipped
4638	ok 15 # SKIP skipped
4639	ok 16 # SKIP skipped
4640	ok 17 # SKIP skipped
4641	ok 18 # SKIP skipped
4642	ok 19 # SKIP skipped
4643	ok 20 # SKIP skipped
4644	ok 21 # SKIP skipped
4645	ok 22 # SKIP skipped
4646	ok 23 # SKIP skipped
4647	ok 24 # SKIP skipped
4648	ok 25 # SKIP skipped
4649	ok 26 # SKIP skipped
4650	ok 27 # SKIP skipped
4651	ok 28 # SKIP skipped
4652	ok 29 # SKIP skipped
4653	ok 30 # SKIP skipped
4654	ok 31 # SKIP skipped
4655	ok 32 # SKIP skipped
4656	ok 33 # SKIP skipped
4657	ok 34 # SKIP skipped
4658	ok 35 # SKIP skipped
4659	ok 36 # SKIP skipped
4660	ok 37 # SKIP skipped
4661	ok 38 # SKIP skipped
4662	ok 39 # SKIP skipped
4663	ok 40 # SKIP skipped
4664	ok 41 # SKIP skipped
4665	ok 42 # SKIP skipped
4666	ok 43 # SKIP skipped
4667	ok
4668	t/library/protoobject..................ok
4669	t/library/rand.........................ok
4670	t/library/range........................ok
4671	t/library/streams......................
4672	ok 18 # SKIP broken method invocation
4673	ok 20 # SKIP broken method invocation
4674	ok
4675	t/library/string_utils.................ok
4676	t/library/tcl_glob.....................ok
4677	t/library/tcl_lib......................ok
4678	t/library/test_builder_tester..........ok
4679	t/library/test_class...................ok
4680	t/library/test_more....................ok
4681	t/library/uuid.........................ok
4682	t/library/yaml_dumper..................
4683	not ok 7 - properties # TODO not yet implemented
4684	not ok 8 - indent string # TODO not supported
4685	not ok 9 - back-referencing properties # TODO not yet implemented
4686	not ok 10 - self-referential properties (1) # TODO not yet implemented
4687	not ok 11 - self-referential properties (2) # TODO not yet implemented
4688	not ok 26 - custom dumper # TODO not yet implemented
4689	ok
4690	t/library/yaml_parser_syck.............
4691	not ok 1 - basic parsing # TODO Not properly implemented yet
4692	ok
4693	All tests successful.
4694	Files=252, Tests=8326, 407 wallclock secs ( 5.99 usr 4.01 sys + 185.26 cusr 109.53 csys = 304.79 CPU)
4695	Result: PASS
4696	perl t/harness --gc-debug --running-make-test -j --runcore-tests
4697	t/compilers/imcc/imcpasm/cfg...........ok
4698	t/compilers/imcc/imcpasm/opt0..........
4699	ok 1 # SKIP disabled graph coloring register allocator, RT #57028
4700	ok 3 # SKIP disabled graph coloring register allocator, RT #57028
4701	ok
4702	t/compilers/imcc/imcpasm/opt1..........
4703	ok 76 # SKIP constant concat N/Y
4704	ok
4705	t/compilers/imcc/imcpasm/opt2..........
4706	ok 5 # SKIP loop opt disabled for now
4707	ok
4708	t/compilers/imcc/imcpasm/optc..........
4709	not ok 9 - tailcall 1 # TODO RT #57028
4710	ok
4711	t/compilers/imcc/imcpasm/pcc...........ok
4712	t/compilers/imcc/imcpasm/sub...........ok
4713	t/compilers/imcc/reg/alloc.............ok
4714	t/compilers/imcc/reg/spill.............ok
4715	t/compilers/imcc/syn/bsr...............ok
4716	t/compilers/imcc/syn/clash.............
4717	not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet
4718	ok
4719	t/compilers/imcc/syn/const.............ok
4720	t/compilers/imcc/syn/errors............ok
4721	t/compilers/imcc/syn/eval..............
4722	ok 1 # SKIP changed eval semantics - see t/pmc/eval.t
4723	ok 2 # SKIP changed eval semantics - see t/pmc/eval.t
4724	ok 3 # SKIP changed eval semantics - see t/pmc/eval.t
4725	ok 4 # SKIP changed eval semantics - see t/pmc/eval.t
4726	ok 5 # SKIP changed eval semantics - see t/pmc/eval.t
4727	ok 6 # SKIP changed eval semantics - see t/pmc/eval.t
4728	ok 7 # SKIP changed eval semantics - see t/pmc/eval.t
4729	ok
4730	t/compilers/imcc/syn/file..............
4731	ok 13 # SKIP multiple loading not speced - failing
4732	ok
4733	t/compilers/imcc/syn/hll...............ok
4734	t/compilers/imcc/syn/keyed.............
4735	ok 1 # SKIP experimental
4736	ok
4737	t/compilers/imcc/syn/labels............ok
4738	t/compilers/imcc/syn/macro.............
4739	not ok 25 - unterminated macro 2 # TODO Darwin segfault -- RT #60926
4740	ok
4741	t/compilers/imcc/syn/objects...........ok
4742	t/compilers/imcc/syn/op................ok
4743	t/compilers/imcc/syn/pasm..............ok
4744	t/compilers/imcc/syn/pcc...............ok
4745	t/compilers/imcc/syn/pod...............
4746	ok 4 # SKIP Closing out of pod from included files
4747	ok
4748	t/compilers/imcc/syn/regressions.......
4749	not ok 4 - comments between .param(RT \#46499) # TODO broken
4750	not ok 6 - whitespace between .param(RT \#46499) # TODO broken
4751	not ok 7 - off by one error message (RT \#40204) # TODO broken
4752	ok
4753	t/compilers/imcc/syn/scope.............ok
4754	t/compilers/imcc/syn/subflags..........
4755	not ok 15 # TODO :method sub not found in namespace
4756	ok
4757	t/compilers/imcc/syn/symbols...........ok
4758	t/compilers/imcc/syn/tail..............ok
4759	t/compilers/imcc/syn/veracity..........ok
4760	t/op/00ff-dos..........................ok
4761	t/op/00ff-unix.........................ok
4762	t/op/01-parse_ops......................
4763	1..0 # Skip IMCC cannot do parse-only with JIT enabled
4764	skipped: IMCC cannot do parse-only with JIT enabled
4765	t/op/64bit.............................
4766	1..0 # Skip 64bit INTVAL platforms only
4767	skipped: 64bit INTVAL platforms only
4768	t/op/annotate..........................ok
4769	t/op/arithmetics.......................
4770	ok 28 # SKIP No integer overflow for 32-bit INTVALs without GMP installed
4771	ok
4772	t/op/basic.............................ok
4773	t/op/bitwise...........................
4774	ok 27 # SKIP no BigInt lib found
4775	ok
4776	t/op/box...............................ok
4777	t/op/calling...........................
4778	not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all
4779	not ok 93 - arg mismatch with no params # TODO RT #39844
4780	ok
4781	t/op/cc_params.........................ok
4782	t/op/cc_state..........................
4783	not ok 6 - positional found, named expected # TODO cc processor state missing
4784	not ok 8 - G2: argument underflow: required slurpy param # TODO failing
4785	ok
4786	t/op/cmp-nonbranch.....................ok
4787	t/op/comp..............................ok
4788	t/op/copy..............................ok
4789	t/op/debuginfo.........................
4790	ok 7 # SKIP disabled on this core
4791	ok 8 # SKIP disabled on this core
4792	ok
4793	t/op/exceptions........................
4794	not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans
4795	ok
4796	t/op/gc................................ok
4797	t/op/globals...........................ok
4798	t/op/hacks.............................
4799	ok 1 # SKIP no universal SIGFPE handling
4800	ok 2 # SKIP no universal SIGFPE handling
4801	ok
4802	t/op/ifunless..........................ok
4803	t/op/integer...........................ok
4804	t/op/interp............................
4805	ok 1 # SKIP we really shouldn't run just a label - use a sub
4806	ok
4807	t/op/io................................ok
4808	t/op/jit...............................ok
4809	t/op/jitn..............................ok
4810	t/op/lexicals..........................
4811	not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented
4812	ok
4813	t/op/literal...........................ok
4814	t/op/load_bytecode.....................ok
4815	t/op/number............................ok
4816	t/op/pushaction........................
4817	not ok 7 - pushaction: error while handling error # TODO runloop shenanigans
4818	ok
4819	t/op/say...............................ok
4820	t/op/spawnw............................ok
4821	t/op/sprintf...........................
4822	ok 5 # SKIP parrot extension (%B)
4823	ok 7 # SKIP perl5-specific extension (%D)
4824	ok 9 # SKIP perl5-specific extension (%F)
4825	ok 16 # SKIP parrot extension (%H)
4826	ok 20 # SKIP parrot extension (%L)
4827	ok 23 # SKIP perl5-specific extension (%O)
4828	ok 24 # SKIP parrot extension (%P)
4829	ok 27 # SKIP parrot extension (%S)
4830	ok 29 # SKIP perl5-specific extension (%U)
4831	not ok 64 # TODO [%03.2d] actual: > 01<
4832	ok 71 # SKIP perl5-specific extension (%v...)
4833	ok 72 # SKIP perl5-specific extension (%v...)
4834	ok 73 # SKIP perl5-specific extension (%v...)
4835	ok 74 # SKIP perl5-specific extension (%v...)
4836	ok 75 # SKIP perl5-specific extension (%v...)
4837	ok 76 # SKIP perl5-specific extension (%v...)
4838	ok 77 # SKIP perl5-specific extension (%v...)
4839	ok 78 # SKIP perl5-specific extension (%v...)
4840	ok 79 # SKIP perl5-specific extension (%v...)
4841	ok 80 # SKIP perl5-specific extension (%v...)
4842	ok 81 # SKIP perl5-specific extension (%v...)
4843	ok 82 # SKIP perl5-specific extension (%v...)
4844	ok 83 # SKIP perl5-specific extension (%v...)
4845	ok 84 # SKIP perl5-specific extension (%v...)
4846	ok 85 # SKIP perl5-specific extension (%v...)
4847	ok 86 # SKIP perl5-specific extension (%v...)
4848	ok 87 # SKIP perl5-specific extension (%v...)
4849	ok 88 # SKIP perl5-specific extension (%v...)
4850	ok 89 # SKIP perl5-specific extension (%v...)
4851	ok 90 # SKIP perl5-specific extension (%v...)
4852	ok 91 # SKIP perl5-specific extension (%v...)
4853	ok 92 # SKIP perl5-specific extension (%v...)
4854	ok 93 # SKIP perl5-specific extension (%v...)
4855	ok 94 # SKIP perl5-specific extension (%v...)
4856	ok 95 # SKIP perl5-specific extension (%v...)
4857	ok 96 # SKIP perl5-specific extension (%v...)
4858	ok 97 # SKIP perl5-specific extension (%v...)
4859	ok 98 # SKIP perl5-specific extension (%v...)
4860	ok 99 # SKIP perl5-specific extension (%v...)
4861	ok 114 # SKIP harness needs support for * modifier
4862	ok 131 # SKIP harness needs support for * modifier
4863	ok 141 # SKIP harness needs support for * modifier
4864	ok 144 # SKIP perl5 expresssion as test value
4865	not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1<
4866	ok 161 # SKIP harness needs support for * modifier
4867	ok 166 # SKIP harness needs support for * modifier
4868	not ok 187 # TODO [%h] actual: ><
4869	not ok 191 # TODO [%l] actual: ><
4870	ok 193 # SKIP perl5-specific test
4871	ok 200 # SKIP perl5-specific test
4872	ok 201 # SKIP perl5-specific test
4873	ok 202 # SKIP parrot extension (%p)
4874	ok 204 # SKIP parrot extension (%r)
4875	ok 210 # SKIP harness needs support for * modifier
4876	ok 214 # SKIP harness needs support for * modifier
4877	not ok 223 # TODO [%v] actual: ><
4878	ok 233 # SKIP harness needs support for * modifier
4879	ok 234 # SKIP perl5-specific extension (%v...)
4880	ok 235 # SKIP perl5-specific extension (%v...)
4881	ok 238 # SKIP perl5-specific test
4882	ok 239 # SKIP perl5-specific test
4883	ok 240 # SKIP perl5-specific test
4884	ok 241 # SKIP perl5-specific test
4885	ok 242 # SKIP perl5-specific test
4886	ok 243 # SKIP perl5-specific test
4887	ok 244 # SKIP perl5-specific test
4888	ok 245 # SKIP perl5-specific test
4889	ok 246 # SKIP perl5-specific test
4890	ok 247 # SKIP perl5-specific test
4891	ok 248 # SKIP perl5-specific test
4892	ok 249 # SKIP perl5-specific test
4893	ok 250 # SKIP perl5-specific test
4894	ok 251 # SKIP perl5-specific test
4895	ok 252 # SKIP perl5-specific extension (%v...)
4896	ok 253 # SKIP perl5-specific extension (%v...)
4897	ok 254 # SKIP perl5-specific extension (%v...)
4898	ok 255 # SKIP perl5-specific extension (%v...)
4899	ok 256 # SKIP perl5-specific extension (%v...)
4900	ok 257 # SKIP perl5-specific extension (%v...)
4901	ok 258 # SKIP perl5-specific extension (%v...)
4902	ok 259 # SKIP perl5-specific extension (%v...)
4903	ok 260 # SKIP perl5-specific extension (%v...)
4904	ok 261 # SKIP perl5-specific extension (%v...)
4905	ok 262 # SKIP perl5-specific extension (%v...)
4906	ok 263 # SKIP perl5-specific extension (%v...)
4907	ok 264 # SKIP perl5-specific extension (%v...)
4908	ok 265 # SKIP perl5-specific extension (%v...)
4909	ok 266 # SKIP perl5-specific extension (%v...)
4910	ok 267 # SKIP perl5-specific extension (%v...)
4911	ok 268 # SKIP perl5-specific extension (%v...)
4912	ok 269 # SKIP perl5-specific extension (%v...)
4913	ok 270 # SKIP perl5-specific extension (%v...)
4914	ok 271 # SKIP perl5-specific extension (%v...)
4915	ok 272 # SKIP perl5-specific extension (%v...)
4916	ok 273 # SKIP perl5-specific extension (%v...)
4917	ok 274 # SKIP perl5-specific extension (%v...)
4918	ok 275 # SKIP perl5-specific extension (%v...)
4919	ok 276 # SKIP perl5-specific extension (%v...)
4920	ok 277 # SKIP perl5-specific extension (%v...)
4921	ok 278 # SKIP perl5-specific extension (%v...)
4922	ok 279 # SKIP perl5-specific extension (%v...)
4923	ok 280 # SKIP perl5-specific extension (%v...)
4924	ok 281 # SKIP perl5-specific extension (%v...)
4925	ok 282 # SKIP perl5-specific extension (%v...)
4926	ok 283 # SKIP perl5-specific extension (%v...)
4927	ok 284 # SKIP perl5-specific extension (%v...)
4928	ok 285 # SKIP perl5-specific extension (%v...)
4929	ok 286 # SKIP perl5-specific extension (%v...)
4930	ok 287 # SKIP perl5-specific extension (%v...)
4931	ok 288 # SKIP perl5-specific extension (%v...)
4932	ok 289 # SKIP perl5-specific extension (%v...)
4933	ok 290 # SKIP perl5-specific extension (%v...)
4934	ok 291 # SKIP perl5-specific extension (%v...)
4935	ok 292 # SKIP perl5-specific extension (%v...)
4936	ok 293 # SKIP perl5-specific extension (%v...)
4937	ok 294 # SKIP perl5-specific extension (%v...)
4938	ok 295 # SKIP perl5-specific extension (%v...)
4939	ok 296 # SKIP perl5-specific extension (%v...)
4940	ok 297 # SKIP perl5-specific extension (%v...)
4941	ok 298 # SKIP perl5-specific extension (%v...)
4942	ok 300 # SKIP harness needs support for * modifier
4943	not ok 304 # TODO [%#b] actual: >0b0<
4944	not ok 305 # TODO [%#o] actual: >00<
4945	not ok 306 # TODO [%#x] actual: >0x0<
4946	ok 307 # SKIP perl5-specific extension (%v...)
4947	ok 308 # SKIP perl5-specific extension (%v...)
4948	ok
4949	t/op/sprintf2..........................ok
4950	t/op/string............................
4951	ok 103 # SKIP Pending rework of creating non-ascii literals
4952	ok 104 # SKIP Pending rework of creating non-ascii literals
4953	ok 118 # SKIP Pending reimplementation of find_encoding
4954	ok 119 # SKIP no more visible encoding
4955	ok 137 # SKIP No unicode yet
4956	ok 139 # SKIP no more transcode
4957	ok 140 # SKIP no more chartype
4958	ok
4959	t/op/string_cclass.....................
4960	ok 7 # SKIP unicode support unavailable
4961	ok 8 # SKIP unicode support unavailable
4962	ok 9 # SKIP unicode support unavailable
4963	ok
4964	t/op/string_cs.........................
4965	ok 31 # SKIP no ICU lib
4966	ok 32 # SKIP no ICU lib
4967	ok 33 # SKIP no ICU lib
4968	ok 34 # SKIP no ICU lib
4969	ok 35 # SKIP no ICU lib
4970	ok 36 # SKIP no ICU lib
4971	ok 37 # SKIP no ICU lib
4972	ok 38 # SKIP no ICU lib
4973	ok 39 # SKIP no ICU lib
4974	ok 40 # SKIP no ICU lib
4975	ok 41 # SKIP no ICU lib
4976	ok 42 # SKIP no ICU lib
4977	ok 43 # SKIP no ICU lib
4978	ok 44 # SKIP no ICU lib
4979	ok 45 # SKIP no ICU lib
4980	ok 46 # SKIP no ICU lib
4981	ok
4982	t/op/string_mem........................ok
4983	t/op/stringu...........................
4984	ok 20 # SKIP no ICU lib
4985	ok 21 # SKIP no ICU lib
4986	ok 22 # SKIP no ICU lib
4987	ok 25 # SKIP Tests seem to fail on big endian machines with icu
4988	ok 26 # SKIP Tests seem to fail on big endian machines with icu
4989	not ok 27 - UTF-8 and Unicode literals # TODO TT #24
4990	ok
4991	t/op/sysinfo...........................
4992	not ok 11 - sysinfo OS version string # TODO Not Currently Implemented
4993	not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented
4994	ok 13 # SKIP Requires a lot of work to find out the correct answer
4995	ok 14 # SKIP Testing only in some known platforms
4996	ok
4997	t/op/time..............................ok
4998	t/op/trans.............................
4999	ok 13 - atan2 # TODO broken under JIT TT #201
5000	ok
5001	t/pmc/addrregistry.....................ok
5002	t/pmc/array............................
5003	not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken
5004	ok
5005	t/pmc/bigint...........................
5006	1..0 # Skip No BigInt Lib configured
5007	skipped: No BigInt Lib configured
5008	t/pmc/bignum...........................
5009	1..0 # Skip No BigNum PMC enabled
5010	skipped: No BigNum PMC enabled
5011	t/pmc/boolean..........................ok
5012	t/pmc/bound_nci........................ok
5013	t/pmc/callsignature....................ok
5014	t/pmc/capture..........................ok
5015	t/pmc/class............................
5016	not ok 28 # TODO add_method() invoking method added to class works
5017	ok
5018	t/pmc/codestring.......................ok
5019	t/pmc/complex..........................
5020	ok 58 # SKIP div by zero not caught
5021	ok 59 # SKIP div by zero not caught
5022	ok 60 # SKIP div by zero not caught
5023	ok 86 # SKIP instantiate n/y
5024	ok 87 # SKIP instantiate n/y
5025	ok 88 # SKIP instantiate n/y
5026	ok 89 # SKIP instantiate n/y
5027	ok 126 # SKIP inf is not platform-independent
5028	ok 465 # SKIP add using subclass of Complex - RT #59630
5029	ok 466 # SKIP add using subclass of Complex - RT #59630
5030	ok 467 # SKIP add using subclass of Complex - RT #59630
5031	ok
5032	t/pmc/config...........................ok
5033	t/pmc/continuation.....................ok
5034	t/pmc/coroutine........................
5035	not ok 9 - Call an exited coroutine # TODO goes one iteration too far.
5036	ok
5037	t/pmc/cpointer.........................ok
5038	t/pmc/default..........................
5039	not ok 1 - new # TODO not implemeted
5040	ok
5041	t/pmc/env..............................ok
5042	t/pmc/eval.............................ok
5043	t/pmc/eventhandler.....................ok
5044	t/pmc/exception........................
5045	not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans
5046	not ok 25 - pushaction: error while handling error # TODO runloop shenanigans
5047	not ok 27 - invoke handler in calling sub # TODO deprecate rethrow
5048	not ok 30 - catch ex from C-level MULTI function # TODO broken
5049	ok
5050	t/pmc/exceptionhandler.................ok
5051	t/pmc/exporter.........................ok
5052	t/pmc/file.............................ok
5053	t/pmc/filehandle.......................
5054	ok 3 # SKIP no asynch calls yet
5055	not ok 8 - record_separator # TODO not yet implemented
5056	ok
5057	t/pmc/fixedbooleanarray................ok
5058	t/pmc/fixedfloatarray..................ok
5059	t/pmc/fixedintegerarray................ok
5060	t/pmc/fixedpmcarray....................ok
5061	t/pmc/fixedstringarray.................ok
5062	t/pmc/float............................ok
5063	t/pmc/freeze...........................ok
5064	t/pmc/globals..........................ok
5065	t/pmc/hash.............................ok
5066	t/pmc/integer..........................ok
5067	t/pmc/io...............................
5068	not ok 1 - IO on some invalid types # TODO IO on some invalid types
5069	ok 8 # SKIP clone not finished yet
5070	not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433
5071	not ok 40 - string read/write handle # TODO no stringhandle yet
5072	ok
5073	t/pmc/io_iterator......................
5074	not ok 1 - new # TODO not yet implemented
5075	not ok 2 - shift # TODO not yet implemented
5076	not ok 3 - get_bool (vtable) # TODO not yet implemented
5077	ok
5078	t/pmc/io_status........................
5079	not ok 1 - new # TODO not yet implemented
5080	not ok 2 - get_integer (vtable) # TODO not yet implemented
5081	not ok 3 - get_bool (vtable) # TODO not yet implemented
5082	not ok 4 - return # TODO not yet implemented
5083	not ok 5 - error # TODO not yet implemented
5084	not ok 6 - throw # TODO not yet implemented
5085	ok
5086	t/pmc/iterator.........................
5087	ok 13 # SKIP N/Y: length of rest of array
5088	not ok 16 - adding keys during iteration # TODO adding keys during iteration
5089	not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points'
5090	ok
5091	t/pmc/key..............................
5092	not ok 10 # TODO register and non-register string keys should be COW (RT #60128)
5093	ok
5094	t/pmc/lexinfo..........................ok
5095	t/pmc/lexpad...........................ok
5096	t/pmc/managedstruct....................ok
5097	t/pmc/multidispatch....................
5098	not ok 22 - MMD on PMC types - Any # TODO RT #41374
5099	not ok 25 - add as method - inherited # TODO RT #41374
5100	not ok 32 - use a core func for an object # TODO RT #59628
5101	ok
5102	t/pmc/multisub.........................ok
5103	t/pmc/namespace........................
5104	not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17
5105	ok
5106	t/pmc/nci..............................
5107	not ok 42 - nci_cb_C1 - PASM # TODO RT #49718, add scheduler tasks to JIT
5108	not ok 43 - nci_cb_C1 - PIR # TODO RT #49718, add scheduler tasks to JIT
5109	not ok 44 - nci_cb_C2 - PASM # TODO RT #49718, add scheduler tasks to JIT
5110	not ok 45 - nci_cb_C3 - PIR # TODO RT #49718, add scheduler tasks to JIT
5111	not ok 46 - nci_cb_D1 - PASM # TODO RT #49718, add scheduler tasks to JIT
5112	not ok 47 - nci_cb_D2 - PASM # TODO RT #49718, add scheduler tasks to JIT
5113	not ok 48 - nci_cb_D2 - PIR # TODO RT #49718, add scheduler tasks to JIT
5114	not ok 49 - nci_cb_D3 - PIR # TODO RT #49718, add scheduler tasks to JIT
5115	ok
5116	t/pmc/null.............................ok
5117	t/pmc/object-meths.....................
5118	ok 14 # SKIP currently broken
5119	ok 25 # SKIP no bound NCI method
5120	ok
5121	t/pmc/object-mro.......................ok
5122	t/pmc/object...........................ok
5123	t/pmc/objects..........................ok
5124	t/pmc/orderedhash......................ok
5125	t/pmc/os...............................ok
5126	t/pmc/packfile.........................ok
5127	t/pmc/packfileconstanttable............
5128	not ok 3 - get_type, get_*_keyed_int # TODO See TT #385.
5129	ok
5130	t/pmc/packfiledirectory................ok
5131	t/pmc/packfilefixupentry...............ok
5132	t/pmc/packfilefixuptable...............ok
5133	t/pmc/packfilerawsegment...............ok
5134	t/pmc/packfilesegment..................ok
5135	t/pmc/parrotclass......................ok
5136	t/pmc/parrotinterpreter................ok
5137	t/pmc/parrotio.........................
5138	not ok 2 - open and close - synchronous # TODO not yet implemented
5139	ok 3 # SKIP no asynch calls yet
5140	not ok 4 - print, read, and readline - synchronous # TODO not yet implemented
5141	not ok 5 - record_separator # TODO not yet implemented
5142	not ok 6 - buffer_type # TODO not yet implemented
5143	ok
5144	t/pmc/parrotlibrary....................ok
5145	t/pmc/parrotobject.....................ok
5146	t/pmc/parrotrunningthread..............ok
5147	t/pmc/parrotthread.....................ok
5148	t/pmc/pccmethod_test...................ok
5149	t/pmc/pmc..............................ok
5150	t/pmc/pmcproxy.........................ok
5151	t/pmc/pointer..........................ok
5152	t/pmc/prop.............................ok
5153	t/pmc/random...........................ok
5154	t/pmc/ref..............................ok
5155	t/pmc/resizablebooleanarray............ok
5156	t/pmc/resizablefloatarray..............ok
5157	t/pmc/resizableintegerarray............ok
5158	t/pmc/resizablepmcarray................ok
5159	t/pmc/resizablestringarray.............ok
5160	t/pmc/retcontinuation..................ok
5161	t/pmc/ro...............................
5162	not ok 8 - ResizablePMCArray -- Recursive # TODO 1
5163	ok
5164	t/pmc/role.............................ok
5165	t/pmc/scalar...........................
5166	ok 1 # SKIP doesn't work yet
5167	ok
5168	t/pmc/scheduler........................ok
5169	t/pmc/schedulermessage.................ok
5170	t/pmc/sharedref........................ok
5171	t/pmc/signal...........................
5172	1..0 # Skip Signals currently disabled
5173	skipped: Signals currently disabled
5174	t/pmc/slice............................
5175	not ok 2 - bug with slice bits # TODO parser
5176	ok
5177	t/pmc/string...........................ok
5178	t/pmc/stringhandle.....................
5179	ok 3 # SKIP no asynch calls yet
5180	not ok 9 - record_separator # TODO not yet implemented
5181	ok
5182	t/pmc/sub..............................ok
5183	t/pmc/sys..............................ok
5184	t/pmc/task.............................ok
5185	t/pmc/threads..........................
5186	not ok 11 - CLONE_CODE \| CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511
5187	not ok 14 - globals + constant table subs issue # TODO Broken with JIT
5188	not ok 15 - CLONE_CODE\|CLONE_GLOBALS\|CLONE_HLL\|CLONE_LIBRARIES # TODO RT #41373
5189	ok
5190	t/pmc/timer............................
5191	not ok 5 - Timer setup - initializer/start/repeat # TODO RT #49718, add scheduler features to JIT
5192	ok
5193	t/pmc/undef............................ok
5194	t/pmc/unmanagedstruct..................ok
5195	t/oo/attributes........................ok
5196	t/oo/composition.......................ok
5197	t/oo/inheritance.......................ok
5198	t/oo/isa...............................ok
5199	t/oo/metamodel.........................
5200	not ok 6 # TODO tail attribute has a type
5201	not ok 12 # TODO new opcode makes working objects
5202	ok
5203	t/oo/methods...........................ok
5204	t/oo/mro-c3............................ok
5205	t/oo/names.............................ok
5206	t/oo/new...............................ok
5207	t/oo/ops...............................ok
5208	t/oo/proxy.............................ok
5209	t/oo/subclass..........................ok
5210	t/oo/vtableoverride....................ok
5211	t/native_pbc/header....................
5212	1..0 # Skip pending robust testing strategy, TT #357
5213	skipped: pending robust testing strategy, TT #357
5214	t/native_pbc/integer...................
5215	1..0 # Skip pending robust testing strategy, TT #357
5216	skipped: pending robust testing strategy, TT #357
5217	t/native_pbc/number....................
5218	1..0 # Skip pending robust testing strategy, TT #357
5219	skipped: pending robust testing strategy, TT #357
5220	t/native_pbc/string....................
5221	1..0 # Skip pending robust testing strategy, TT #357
5222	skipped: pending robust testing strategy, TT #357
5223	t/dynpmc/dynlexpad.....................
5224	not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads
5225	ok
5226	t/dynpmc/foo...........................
5227	ok 6 # SKIP No BigInt Lib configured
5228	ok
5229	t/dynpmc/gdbmhash......................
5230	1..0 # Skip No gdbm library available
5231	skipped: No gdbm library available
5232	t/dynpmc/md2...........................ok
5233	t/dynpmc/md4...........................ok
5234	t/dynpmc/md5...........................ok
5235	t/dynpmc/pair..........................ok
5236	t/dynpmc/rational......................ok
5237	t/dynpmc/ripemd160.....................ok
5238	t/dynpmc/rotest........................ok
5239	t/dynpmc/sha...........................ok
5240	t/dynpmc/sha1..........................ok
5241	t/dynpmc/sha256........................
5242	1..0 # Skip Too old library
5243	skipped: Too old library
5244	t/dynpmc/sha512........................
5245	1..0 # Skip Too old library
5246	skipped: Too old library
5247	t/dynpmc/subclass_with_pir_method......
5248	not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces
5249	not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces
5250	ok
5251	t/dynpmc/subproxy......................ok
5252	t/dynoplibs/dan........................ok
5253	t/dynoplibs/myops......................
5254	not ok 4 - a short cheating quine # TODO broken with JIT
5255	not ok 5 - one alarm # TODO RT #49718, add scheduler features to JIT
5256	not ok 6 - three alarm # TODO RT #49718, add scheduler features to JIT
5257	not ok 7 - repeating alarm # TODO RT #49718, add scheduler features to JIT
5258	ok
5259	t/compilers/pct/complete_workflow......ok
5260	t/compilers/pct/past...................ok
5261	t/compilers/pct/pct_hllcompiler........ok
5262	t/compilers/pct/post...................ok
5263	t/compilers/pge/00-basic...............ok
5264	t/compilers/pge/02-match...............ok
5265	t/compilers/pge/03-optable.............ok
5266	t/compilers/pge/04-compile.............ok
5267	t/compilers/pge/06-grammar.............ok
5268	t/compilers/pge/pge-hs.................ok
5269	t/compilers/pge/pge....................ok
5270	t/compilers/pge/pge_examples...........
5271	# Failed test 'parse FASTA'
5272	# at t/compilers/pge/pge_examples.t line 55.
5273	# Exited with error code: [SIGNAL 11]
5274	# Received:
5275	#
5276	# Expected:
5277	# >gi\|5524211\|gb\|AAD44166.1\| cytochrome b [Elephas maximus maximus]
5278	# LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
5279	# EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG
5280	# LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL
5281	# GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX
5282	# IENY
5283	# >poly_a teasing the parser with DNA
5284	# aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
5285	#
5286	# Looks like you failed 1 test of 2.
5287	Dubious, test returned 1 (wstat 256, 0x100)
5288	Failed 1/2 subtests
5289	t/compilers/pge/pge_globs..............ok
5290	t/compilers/pge/pge_text...............ok
5291	t/compilers/pge/pge_util...............ok
5292	t/compilers/pge/p5regex/p5rx...........
5293	not ok 116 # TODO [re_tests:116] character class in enumeration
5294	not ok 119 # TODO [re_tests:119] character class in enumeration
5295	not ok 120 # TODO [re_tests:120] character class in enumeration
5296	not ok 123 # TODO [re_tests:123] character class in enumeration
5297	not ok 124 # TODO [re_tests:124] character class in enumeration
5298	not ok 127 # TODO [re_tests:127] character class in enumeration
5299	ok 138 # SKIP [re_tests:138] parser bug
5300	ok 139 # SKIP [re_tests:139] broken col 4?
5301	ok 143 # SKIP [re_tests:143] bug or error
5302	ok 144 # SKIP [re_tests:144] bug or error
5303	ok 148 # SKIP [re_tests:148] bug or error
5304	ok 149 # SKIP [re_tests:149] bug or error
5305	ok 155 # SKIP [re_tests:155] bug or error
5306	ok 167 # SKIP [re_tests:167] bug or error
5307	not ok 234 # TODO [re_tests:234] unknown reason
5308	not ok 235 # TODO [re_tests:235] unknown reason
5309	not ok 236 # TODO [re_tests:236] unknown reason
5310	not ok 246 # TODO [re_tests:246] unknown reason
5311	not ok 247 # TODO [re_tests:247] unknown reason
5312	ok 248 # SKIP [re_tests:248] bug or error
5313	ok 249 # SKIP [re_tests:249] bug or error
5314	ok 252 # SKIP [re_tests:252] bug or error
5315	not ok 254 # TODO [re_tests:254] unknown reason
5316	not ok 256 # TODO [re_tests:256] unknown reason
5317	not ok 257 # TODO [re_tests:257] unknown reason
5318	ok 264 # SKIP [re_tests:264] trailing modifiers
5319	ok 265 # SKIP [re_tests:265] trailing modifiers
5320	ok 266 # SKIP [re_tests:266] trailing modifiers
5321	ok 267 # SKIP [re_tests:267] trailing modifiers
5322	ok 268 # SKIP [re_tests:268] trailing modifiers
5323	ok 269 # SKIP [re_tests:269] trailing modifiers
5324	ok 270 # SKIP [re_tests:270] trailing modifiers
5325	ok 271 # SKIP [re_tests:271] trailing modifiers
5326	ok 272 # SKIP [re_tests:272] trailing modifiers
5327	ok 273 # SKIP [re_tests:273] trailing modifiers
5328	ok 274 # SKIP [re_tests:274] trailing modifiers
5329	ok 275 # SKIP [re_tests:275] trailing modifiers
5330	ok 276 # SKIP [re_tests:276] trailing modifiers
5331	ok 277 # SKIP [re_tests:277] trailing modifiers
5332	ok 278 # SKIP [re_tests:278] trailing modifiers
5333	ok 279 # SKIP [re_tests:279] trailing modifiers
5334	ok 280 # SKIP [re_tests:280] trailing modifiers
5335	ok 281 # SKIP [re_tests:281] trailing modifiers
5336	ok 282 # SKIP [re_tests:282] trailing modifiers
5337	ok 283 # SKIP [re_tests:283] trailing modifiers
5338	ok 284 # SKIP [re_tests:284] trailing modifiers
5339	ok 285 # SKIP [re_tests:285] trailing modifiers
5340	ok 286 # SKIP [re_tests:286] trailing modifiers
5341	ok 287 # SKIP [re_tests:287] trailing modifiers
5342	ok 288 # SKIP [re_tests:288] trailing modifiers
5343	ok 289 # SKIP [re_tests:289] trailing modifiers
5344	ok 290 # SKIP [re_tests:290] trailing modifiers
5345	ok 291 # SKIP [re_tests:291] trailing modifiers
5346	ok 292 # SKIP [re_tests:292] trailing modifiers
5347	ok 293 # SKIP [re_tests:293] trailing modifiers
5348	ok 294 # SKIP [re_tests:294] trailing modifiers
5349	ok 295 # SKIP [re_tests:295] trailing modifiers
5350	ok 296 # SKIP [re_tests:296] trailing modifiers
5351	ok 297 # SKIP [re_tests:297] trailing modifiers
5352	ok 298 # SKIP [re_tests:298] trailing modifiers
5353	ok 299 # SKIP [re_tests:299] trailing modifiers
5354	ok 300 # SKIP [re_tests:300] trailing modifiers
5355	ok 301 # SKIP [re_tests:301] trailing modifiers
5356	ok 302 # SKIP [re_tests:302] trailing modifiers
5357	ok 303 # SKIP [re_tests:303] trailing modifiers
5358	ok 304 # SKIP [re_tests:304] trailing modifiers
5359	ok 305 # SKIP [re_tests:305] trailing modifiers
5360	ok 306 # SKIP [re_tests:306] trailing modifiers
5361	ok 307 # SKIP [re_tests:307] trailing modifiers
5362	ok 308 # SKIP [re_tests:308] bug or error
5363	ok 309 # SKIP [re_tests:309] bug or error
5364	ok 310 # SKIP [re_tests:310] bug or error
5365	ok 311 # SKIP [re_tests:311] trailing modifiers
5366	ok 312 # SKIP [re_tests:312] trailing modifiers
5367	ok 313 # SKIP [re_tests:313] trailing modifiers
5368	ok 314 # SKIP [re_tests:314] trailing modifiers
5369	ok 315 # SKIP [re_tests:315] trailing modifiers
5370	ok 316 # SKIP [re_tests:316] trailing modifiers
5371	ok 317 # SKIP [re_tests:317] trailing modifiers
5372	ok 318 # SKIP [re_tests:318] trailing modifiers
5373	ok 319 # SKIP [re_tests:319] trailing modifiers
5374	ok 320 # SKIP [re_tests:320] trailing modifiers
5375	ok 321 # SKIP [re_tests:321] trailing modifiers
5376	ok 322 # SKIP [re_tests:322] bug or error
5377	ok 323 # SKIP [re_tests:323] bug or error
5378	ok 324 # SKIP [re_tests:324] trailing modifiers
5379	ok 325 # SKIP [re_tests:325] bug or error
5380	ok 326 # SKIP [re_tests:326] trailing modifiers
5381	ok 327 # SKIP [re_tests:327] trailing modifiers
5382	ok 328 # SKIP [re_tests:328] trailing modifiers
5383	ok 329 # SKIP [re_tests:329] trailing modifiers
5384	ok 330 # SKIP [re_tests:330] bug or error
5385	ok 331 # SKIP [re_tests:331] bug or error
5386	ok 332 # SKIP [re_tests:332] trailing modifiers
5387	ok 333 # SKIP [re_tests:333] trailing modifiers
5388	ok 334 # SKIP [re_tests:334] trailing modifiers
5389	ok 335 # SKIP [re_tests:335] trailing modifiers
5390	ok 336 # SKIP [re_tests:336] bug or error
5391	ok 337 # SKIP [re_tests:337] trailing modifiers
5392	ok 338 # SKIP [re_tests:338] trailing modifiers
5393	ok 339 # SKIP [re_tests:339] trailing modifiers
5394	ok 340 # SKIP [re_tests:340] trailing modifiers
5395	ok 341 # SKIP [re_tests:341] trailing modifiers
5396	ok 342 # SKIP [re_tests:342] trailing modifiers
5397	ok 343 # SKIP [re_tests:343] trailing modifiers
5398	ok 344 # SKIP [re_tests:344] trailing modifiers
5399	ok 345 # SKIP [re_tests:345] trailing modifiers
5400	ok 346 # SKIP [re_tests:346] trailing modifiers
5401	ok 347 # SKIP [re_tests:347] bug or error
5402	ok 348 # SKIP [re_tests:348] trailing modifiers
5403	ok 349 # SKIP [re_tests:349] trailing modifiers
5404	ok 350 # SKIP [re_tests:350] trailing modifiers
5405	ok 351 # SKIP [re_tests:351] trailing modifiers
5406	ok 352 # SKIP [re_tests:352] trailing modifiers
5407	ok 353 # SKIP [re_tests:353] trailing modifiers
5408	ok 354 # SKIP [re_tests:354] trailing modifiers
5409	ok 355 # SKIP [re_tests:355] trailing modifiers
5410	ok 356 # SKIP [re_tests:356] trailing modifiers
5411	ok 357 # SKIP [re_tests:357] trailing modifiers
5412	ok 358 # SKIP [re_tests:358] trailing modifiers
5413	ok 359 # SKIP [re_tests:359] trailing modifiers
5414	ok 360 # SKIP [re_tests:360] trailing modifiers
5415	ok 361 # SKIP [re_tests:361] trailing modifiers
5416	ok 362 # SKIP [re_tests:362] trailing modifiers
5417	ok 363 # SKIP [re_tests:363] trailing modifiers
5418	ok 364 # SKIP [re_tests:364] trailing modifiers
5419	ok 365 # SKIP [re_tests:365] trailing modifiers
5420	ok 366 # SKIP [re_tests:366] trailing modifiers
5421	ok 367 # SKIP [re_tests:367] trailing modifiers
5422	ok 368 # SKIP [re_tests:368] trailing modifiers
5423	ok 369 # SKIP [re_tests:369] trailing modifiers
5424	ok 370 # SKIP [re_tests:370] trailing modifiers
5425	ok 371 # SKIP [re_tests:371] trailing modifiers
5426	ok 372 # SKIP [re_tests:372] trailing modifiers
5427	ok 373 # SKIP [re_tests:373] trailing modifiers
5428	ok 374 # SKIP [re_tests:374] trailing modifiers
5429	ok 375 # SKIP [re_tests:375] trailing modifiers
5430	ok 376 # SKIP [re_tests:376] trailing modifiers
5431	ok 377 # SKIP [re_tests:377] trailing modifiers
5432	ok 378 # SKIP [re_tests:378] trailing modifiers
5433	ok 379 # SKIP [re_tests:379] trailing modifiers
5434	ok 380 # SKIP [re_tests:380] trailing modifiers
5435	ok 381 # SKIP [re_tests:381] trailing modifiers
5436	ok 382 # SKIP [re_tests:382] trailing modifiers
5437	ok 383 # SKIP [re_tests:383] trailing modifiers
5438	ok 384 # SKIP [re_tests:384] trailing modifiers
5439	ok 385 # SKIP [re_tests:385] trailing modifiers
5440	ok 386 # SKIP [re_tests:386] trailing modifiers
5441	ok 387 # SKIP [re_tests:387] trailing modifiers
5442	ok 388 # SKIP [re_tests:388] trailing modifiers
5443	ok 389 # SKIP [re_tests:389] trailing modifiers
5444	ok 390 # SKIP [re_tests:390] trailing modifiers
5445	ok 391 # SKIP [re_tests:391] trailing modifiers
5446	ok 392 # SKIP [re_tests:392] trailing modifiers
5447	ok 393 # SKIP [re_tests:393] trailing modifiers
5448	ok 394 # SKIP [re_tests:394] trailing modifiers
5449	ok 395 # SKIP [re_tests:395] trailing modifiers
5450	not ok 396 # TODO [re_tests:396] unknown reason
5451	not ok 397 # TODO [re_tests:397] unknown reason
5452	not ok 398 # TODO [re_tests:398] unknown reason
5453	ok 408 # SKIP [re_tests:408] bug or error
5454	not ok 419 # TODO [re_tests:419] unknown reason
5455	not ok 422 # TODO [re_tests:422] unknown reason
5456	not ok 429 # TODO [re_tests:429] unknown reason
5457	not ok 432 # TODO [re_tests:432] unknown reason
5458	not ok 434 # TODO [re_tests:434] unknown reason
5459	not ok 435 # TODO [re_tests:435] unknown reason
5460	ok 436 # SKIP [re_tests:436] bug or error
5461	not ok 439 # TODO [re_tests:439] unknown reason
5462	not ok 446 # TODO [re_tests:446] unknown reason
5463	not ok 447 # TODO [re_tests:447] unknown reason
5464	not ok 448 # TODO [re_tests:448] unknown reason
5465	not ok 449 # TODO [re_tests:449] unknown reason
5466	not ok 452 # TODO [re_tests:452] unknown reason
5467	not ok 453 # TODO [re_tests:453] unknown reason
5468	not ok 454 # TODO [re_tests:454] unknown reason
5469	not ok 455 # TODO [re_tests:455] unknown reason
5470	ok 458 # SKIP [re_tests:458] unknown reason
5471	ok 459 # SKIP [re_tests:459] unknown reason
5472	ok 460 # SKIP [re_tests:460] unknown reason
5473	ok 461 # SKIP [re_tests:461] unknown reason
5474	ok 462 # SKIP [re_tests:462] unknown reason
5475	ok 463 # SKIP [re_tests:463] unknown reason
5476	ok 464 # SKIP [re_tests:464] unknown reason
5477	ok 465 # SKIP [re_tests:465] unknown reason
5478	ok 466 # SKIP [re_tests:466] unknown reason
5479	ok 467 # SKIP [re_tests:467] unknown reason
5480	ok 468 # SKIP [re_tests:468] unknown reason
5481	ok 469 # SKIP [re_tests:469] unknown reason
5482	ok 470 # SKIP [re_tests:470] unknown reason
5483	ok 471 # SKIP [re_tests:471] unknown reason
5484	ok 472 # SKIP [re_tests:472] unknown reason
5485	ok 473 # SKIP [re_tests:473] unknown reason
5486	ok 474 # SKIP [re_tests:474] unknown reason
5487	ok 475 # SKIP [re_tests:475] unknown reason
5488	ok 476 # SKIP [re_tests:476] unknown reason
5489	ok 477 # SKIP [re_tests:477] unknown reason
5490	ok 478 # SKIP [re_tests:478] unknown reason
5491	ok 479 # SKIP [re_tests:479] unknown reason
5492	ok 480 # SKIP [re_tests:480] unknown reason
5493	ok 483 # SKIP [re_tests:483]
5494	ok 484 # SKIP [re_tests:484]
5495	ok 487 # SKIP [re_tests:487] bug or error
5496	ok 488 # SKIP [re_tests:488] bug or error
5497	ok 489 # SKIP [re_tests:489] bug or error
5498	ok 490 # SKIP [re_tests:490] bug or error
5499	ok 491 # SKIP [re_tests:491] kills a parrot
5500	ok 492 # SKIP [re_tests:492] bug or error
5501	ok 493 # SKIP [re_tests:493] kills a parrot
5502	not ok 495 # TODO [re_tests:495] unknown reason
5503	ok 496 # SKIP [re_tests:496]
5504	not ok 498 # TODO [re_tests:498] unknown reason
5505	not ok 500 # TODO [re_tests:500] unknown reason
5506	not ok 501 # TODO [re_tests:501] unknown reason
5507	ok 502 # SKIP [re_tests:502] unknown reason
5508	not ok 503 # TODO [re_tests:503] unknown reason
5509	not ok 504 # TODO [re_tests:504] unknown reason
5510	not ok 505 # TODO [re_tests:505] unknown reason
5511	not ok 506 # TODO [re_tests:506] unknown reason
5512	not ok 507 # TODO [re_tests:507] unknown reason
5513	not ok 508 # TODO [re_tests:508] unknown reason
5514	not ok 509 # TODO [re_tests:509] unknown reason
5515	not ok 510 # TODO [re_tests:510] unknown reason
5516	not ok 511 # TODO [re_tests:511] unknown reason
5517	not ok 512 # TODO [re_tests:512] unknown reason
5518	not ok 515 # TODO [re_tests:515] unknown reason
5519	not ok 521 # TODO [re_tests:521] unknown reason
5520	not ok 522 # TODO [re_tests:522] unknown reason
5521	not ok 523 # TODO [re_tests:523] unknown reason
5522	not ok 524 # TODO [re_tests:524] unknown reason
5523	not ok 527 # TODO [re_tests:527] unknown reason
5524	not ok 528 # TODO [re_tests:528] unknown reason
5525	ok 531 # SKIP [re_tests:531] bug or error
5526	ok 532 # SKIP [re_tests:532] bug or error
5527	not ok 535 # TODO [re_tests:535] unknown reason
5528	not ok 536 # TODO [re_tests:536] unknown reason
5529	not ok 539 # TODO [re_tests:539] unknown reason
5530	not ok 540 # TODO [re_tests:540] unknown reason
5531	not ok 541 # TODO [re_tests:541] unknown reason
5532	not ok 544 # TODO [re_tests:544] unknown reason
5533	not ok 545 # TODO [re_tests:545] unknown reason
5534	ok 556 # SKIP [re_tests:556] kills a parrot
5535	ok 557 # SKIP [re_tests:557] kills a parrot
5536	not ok 559 # TODO [re_tests:559] unknown reason
5537	ok 563 # SKIP [re_tests:563] bug or error
5538	ok 564 # SKIP [re_tests:564] bug or error
5539	ok 566 # SKIP [re_tests:566] bug or error
5540	ok 568 # SKIP [re_tests:568] kills a parrot
5541	ok 569 # SKIP [re_tests:569] kills a parrot
5542	ok 570 # SKIP [re_tests:570] kills a parrot
5543	ok 571 # SKIP [re_tests:571] kills a parrot
5544	ok 572 # SKIP [re_tests:572] kills a parrot
5545	ok 573 # SKIP [re_tests:573] kills a parrot
5546	ok 574 # SKIP [re_tests:574] kills a parrot
5547	ok 575 # SKIP [re_tests:575] kills a parrot
5548	ok 576 # SKIP [re_tests:576] kills a parrot
5549	ok 577 # SKIP [re_tests:577] kills a parrot
5550	ok 578 # SKIP [re_tests:578] kills a parrot
5551	ok 579 # SKIP [re_tests:579] kills a parrot
5552	ok 580 # SKIP [re_tests:580] kills a parrot
5553	ok 581 # SKIP [re_tests:581] kills a parrot
5554	ok 582 # SKIP [re_tests:582] kills a parrot
5555	ok 583 # SKIP [re_tests:583] kills a parrot
5556	ok 584 # SKIP [re_tests:584] kills a parrot
5557	ok 585 # SKIP [re_tests:585] kills a parrot
5558	ok 586 # SKIP [re_tests:586] kills a parrot
5559	ok 587 # SKIP [re_tests:587] kills a parrot
5560	ok 588 # SKIP [re_tests:588] kills a parrot
5561	ok 589 # SKIP [re_tests:589] kills a parrot
5562	ok 590 # SKIP [re_tests:590] kills a parrot
5563	ok 591 # SKIP [re_tests:591] kills a parrot
5564	ok 592 # SKIP [re_tests:592] kills a parrot
5565	ok 593 # SKIP [re_tests:593] bug or error
5566	ok 594 # SKIP [re_tests:594] bug or error
5567	not ok 595 # TODO [re_tests:595] unknown reason
5568	not ok 596 # TODO [re_tests:596] unknown reason
5569	ok 597 # SKIP [re_tests:597] unknown reason
5570	ok 598 # SKIP [re_tests:598] bug or error
5571	ok 599 # SKIP [re_tests:599] bug or error
5572	not ok 600 # TODO [re_tests:600] unknown reason
5573	not ok 601 # TODO [re_tests:601] unknown reason
5574	not ok 603 # TODO [re_tests:603] unknown reason
5575	not ok 604 # TODO [re_tests:604] unknown reason
5576	not ok 606 # TODO [re_tests:606] unknown reason
5577	not ok 607 # TODO [re_tests:607] unknown reason
5578	ok 609 # SKIP [re_tests:609] unknown reason
5579	ok 610 # SKIP [re_tests:610] unknown reason
5580	ok 611 # SKIP [re_tests:611] unknown reason
5581	ok 612 # SKIP [re_tests:612] unknown reason
5582	ok 613 # SKIP [re_tests:613] unknown reason
5583	ok 614 # SKIP [re_tests:614] unknown reason
5584	ok 615 # SKIP [re_tests:615] unknown reason
5585	ok 616 # SKIP [re_tests:616] unknown reason
5586	ok 617 # SKIP [re_tests:617] unknown reason
5587	not ok 621 # TODO [re_tests:621] unknown reason
5588	not ok 623 # TODO [re_tests:623] unknown reason
5589	not ok 624 # TODO [re_tests:624] unknown reason
5590	not ok 625 # TODO [re_tests:625] unknown reason
5591	ok 627 # SKIP [re_tests:627] unknown reason
5592	ok 628 # SKIP [re_tests:628] unknown reason
5593	ok 629 # SKIP [re_tests:629] unknown reason
5594	ok 630 # SKIP [re_tests:630] unknown reason
5595	ok 631 # SKIP [re_tests:631] unknown reason
5596	ok 632 # SKIP [re_tests:632] unknown reason
5597	ok 633 # SKIP [re_tests:633] unknown reason
5598	ok 634 # SKIP [re_tests:634] unknown reason
5599	ok 635 # SKIP [re_tests:635] unknown reason
5600	not ok 639 # TODO [re_tests:639] unknown reason
5601	not ok 641 # TODO [re_tests:641] unknown reason
5602	not ok 642 # TODO [re_tests:642] unknown reason
5603	not ok 643 # TODO [re_tests:643] unknown reason
5604	ok 645 # SKIP [re_tests:645] unknown reason
5605	ok 646 # SKIP [re_tests:646] unknown reason
5606	ok 647 # SKIP [re_tests:647] unknown reason
5607	ok 648 # SKIP [re_tests:648] unknown reason
5608	ok 649 # SKIP [re_tests:649] unknown reason
5609	ok 650 # SKIP [re_tests:650] unknown reason
5610	ok 651 # SKIP [re_tests:651] unknown reason
5611	ok 652 # SKIP [re_tests:652] unknown reason
5612	ok 653 # SKIP [re_tests:653] unknown reason
5613	ok 663 # SKIP [re_tests:663] unknown reason
5614	ok 664 # SKIP [re_tests:664] unknown reason
5615	ok 665 # SKIP [re_tests:665] unknown reason
5616	ok 666 # SKIP [re_tests:666] unknown reason
5617	ok 667 # SKIP [re_tests:667] unknown reason
5618	ok 668 # SKIP [re_tests:668] unknown reason
5619	ok 669 # SKIP [re_tests:669] unknown reason
5620	ok 670 # SKIP [re_tests:670] unknown reason
5621	ok 671 # SKIP [re_tests:671] unknown reason
5622	ok 681 # SKIP [re_tests:681] unknown reason
5623	ok 682 # SKIP [re_tests:682] unknown reason
5624	ok 683 # SKIP [re_tests:683] unknown reason
5625	ok 684 # SKIP [re_tests:684] unknown reason
5626	ok 685 # SKIP [re_tests:685] unknown reason
5627	ok 686 # SKIP [re_tests:686] unknown reason
5628	ok 687 # SKIP [re_tests:687] unknown reason
5629	ok 688 # SKIP [re_tests:688] unknown reason
5630	ok 689 # SKIP [re_tests:689] unknown reason
5631	not ok 693 # TODO [re_tests:693] unknown reason
5632	not ok 695 # TODO [re_tests:695] unknown reason
5633	not ok 696 # TODO [re_tests:696] unknown reason
5634	not ok 697 # TODO [re_tests:697] unknown reason
5635	ok 699 # SKIP [re_tests:699] unknown reason
5636	ok 700 # SKIP [re_tests:700] unknown reason
5637	ok 701 # SKIP [re_tests:701] unknown reason
5638	ok 702 # SKIP [re_tests:702] unknown reason
5639	ok 703 # SKIP [re_tests:703] unknown reason
5640	ok 704 # SKIP [re_tests:704] unknown reason
5641	ok 705 # SKIP [re_tests:705] unknown reason
5642	ok 706 # SKIP [re_tests:706] unknown reason
5643	ok 707 # SKIP [re_tests:707] unknown reason
5644	ok 717 # SKIP [re_tests:717] unknown reason
5645	ok 718 # SKIP [re_tests:718] unknown reason
5646	ok 719 # SKIP [re_tests:719] unknown reason
5647	ok 720 # SKIP [re_tests:720] unknown reason
5648	ok 721 # SKIP [re_tests:721] unknown reason
5649	ok 722 # SKIP [re_tests:722] unknown reason
5650	ok 723 # SKIP [re_tests:723] unknown reason
5651	ok 724 # SKIP [re_tests:724] unknown reason
5652	ok 725 # SKIP [re_tests:725] unknown reason
5653	ok 735 # SKIP [re_tests:735] unknown reason
5654	ok 736 # SKIP [re_tests:736] unknown reason
5655	ok 737 # SKIP [re_tests:737] unknown reason
5656	ok 738 # SKIP [re_tests:738] unknown reason
5657	ok 739 # SKIP [re_tests:739] unknown reason
5658	ok 740 # SKIP [re_tests:740] unknown reason
5659	ok 741 # SKIP [re_tests:741] unknown reason
5660	ok 742 # SKIP [re_tests:742] unknown reason
5661	ok 743 # SKIP [re_tests:743] unknown reason
5662	not ok 747 # TODO [re_tests:747] unknown reason
5663	not ok 749 # TODO [re_tests:749] unknown reason
5664	not ok 750 # TODO [re_tests:750] unknown reason
5665	not ok 751 # TODO [re_tests:751] unknown reason
5666	ok 753 # SKIP [re_tests:753] unknown reason
5667	ok 754 # SKIP [re_tests:754] unknown reason
5668	ok 755 # SKIP [re_tests:755] unknown reason
5669	ok 756 # SKIP [re_tests:756] unknown reason
5670	ok 757 # SKIP [re_tests:757] unknown reason
5671	ok 758 # SKIP [re_tests:758] unknown reason
5672	ok 759 # SKIP [re_tests:759] unknown reason
5673	ok 760 # SKIP [re_tests:760] unknown reason
5674	ok 761 # SKIP [re_tests:761] unknown reason
5675	ok 771 # SKIP [re_tests:771] unknown reason
5676	ok 772 # SKIP [re_tests:772] unknown reason
5677	ok 773 # SKIP [re_tests:773] unknown reason
5678	ok 774 # SKIP [re_tests:774] unknown reason
5679	ok 775 # SKIP [re_tests:775] unknown reason
5680	ok 776 # SKIP [re_tests:776] unknown reason
5681	ok 777 # SKIP [re_tests:777] unknown reason
5682	ok 778 # SKIP [re_tests:778] unknown reason
5683	ok 779 # SKIP [re_tests:779] unknown reason
5684	ok 789 # SKIP [re_tests:789] unknown reason
5685	ok 790 # SKIP [re_tests:790] unknown reason
5686	ok 791 # SKIP [re_tests:791] unknown reason
5687	ok 792 # SKIP [re_tests:792] unknown reason
5688	ok 793 # SKIP [re_tests:793] unknown reason
5689	ok 794 # SKIP [re_tests:794] unknown reason
5690	ok 795 # SKIP [re_tests:795] unknown reason
5691	ok 796 # SKIP [re_tests:796] unknown reason
5692	ok 797 # SKIP [re_tests:797] unknown reason
5693	ok 800 # SKIP [re_tests:800]
5694	not ok 801 # TODO [re_tests:801] unknown reason
5695	ok 802 # SKIP [re_tests:802]
5696	ok 803 # SKIP [re_tests:803]
5697	ok 805 # SKIP [re_tests:805]
5698	ok 806 # SKIP [re_tests:806] hangs a parrot
5699	ok 807 # SKIP [re_tests:807] hangs a parrot
5700	ok 808 # SKIP [re_tests:808] hangs a parrot
5701	ok 809 # SKIP [re_tests:809] hangs a parrot
5702	ok 810 # SKIP [re_tests:810] hangs a parrot
5703	ok 811 # SKIP [re_tests:811] hangs a parrot
5704	ok 812 # SKIP [re_tests:812] hangs a parrot
5705	ok 813 # SKIP [re_tests:813] hangs a parrot
5706	ok 814 # SKIP [re_tests:814] hangs a parrot
5707	ok 815 # SKIP [re_tests:815] hangs a parrot
5708	ok 816 # SKIP [re_tests:816] hangs a parrot
5709	ok 817 # SKIP [re_tests:817] hangs a parrot
5710	ok 818 # SKIP [re_tests:818] hangs a parrot
5711	ok 819 # SKIP [re_tests:819] hangs a parrot
5712	ok 820 # SKIP [re_tests:820] hangs a parrot
5713	ok 821 # SKIP [re_tests:821] hangs a parrot
5714	ok 822 # SKIP [re_tests:822] hangs a parrot
5715	ok 823 # SKIP [re_tests:823] hangs a parrot
5716	not ok 827 # TODO [re_tests:827] \d in character class
5717	ok 828 # SKIP [re_tests:828]
5718	ok 829 # SKIP [re_tests:829]
5719	ok 830 # SKIP [re_tests:830]
5720	ok 834 # SKIP [re_tests:834]
5721	ok 835 # SKIP [re_tests:835]
5722	ok 836 # SKIP [re_tests:836]
5723	ok 838 # SKIP [re_tests:838]
5724	not ok 858 # TODO [re_tests:858] unknown reason
5725	ok 859 # SKIP [re_tests:859]
5726	ok 862 # SKIP [re_tests:862]
5727	not ok 865 # TODO [re_tests:865] unknown reason
5728	not ok 866 # TODO [re_tests:866] unknown reason
5729	ok 877 # SKIP [re_tests:877]
5730	ok 879 # SKIP [re_tests:879] [ID 20010811.006]
5731	not ok 881 # TODO [re_tests:881] unknown reason
5732	ok 886 # SKIP [re_tests:886]
5733	not ok 887 # TODO [re_tests:887] unknown reason
5734	not ok 888 # TODO [re_tests:888] unknown reason
5735	not ok 890 # TODO [re_tests:890] unknown reason
5736	not ok 891 # TODO [re_tests:891] unknown reason
5737	not ok 893 # TODO [re_tests:893] unknown reason
5738	not ok 896 # TODO [re_tests:896] unknown reason
5739	not ok 897 # TODO [re_tests:897] unknown reason
5740	not ok 898 # TODO [re_tests:898] unknown reason
5741	not ok 899 # TODO [re_tests:899] unknown reason
5742	not ok 901 # TODO [re_tests:901] greediness/lookbehind
5743	not ok 904 # TODO [re_tests:904] greediness/lookbehind
5744	not ok 905 # TODO [re_tests:905] greediness/lookbehind
5745	not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion
5746	not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion
5747	not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion
5748	not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion
5749	not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion
5750	not ok 915 # TODO [re_tests:915] non-greedy/lookbehind
5751	not ok 916 # TODO [re_tests:916] non-greedy/lookbehind
5752	not ok 918 # TODO [re_tests:918] non-greedy/lookbehind
5753	not ok 921 # TODO [re_tests:921] non-greedy/lookbehind
5754	not ok 922 # TODO [re_tests:922] non-greedy/lookbehind
5755	not ok 923 # TODO [re_tests:923] unmatched bracket
5756	ok 924 # SKIP [re_tests:924]
5757	ok 926 # SKIP [re_tests:926] [perl #18019]
5758	not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171]
5759	not ok 928 # TODO [re_tests:928] reuse captured group
5760	not ok 929 # TODO [re_tests:929] reuse captured group
5761	not ok 930 # TODO [re_tests:930] reuse captured group
5762	not ok 931 # TODO [re_tests:931] reuse captured group
5763	not ok 932 # TODO [re_tests:932] reuse captured group
5764	not ok 933 # TODO [re_tests:933] reuse captured group
5765	not ok 934 # TODO [re_tests:934] reuse captured group
5766	not ok 935 # TODO [re_tests:935] reuse captured group
5767	not ok 936 # TODO [re_tests:936] reuse captured group
5768	not ok 937 # TODO [re_tests:937] reuse captured group
5769	not ok 938 # TODO [re_tests:938] reuse captured group
5770	not ok 939 # TODO [re_tests:939] reuse captured group
5771	not ok 940 # TODO [re_tests:940] reuse captured group
5772	not ok 941 # TODO [re_tests:941] reuse captured group
5773	not ok 942 # TODO [re_tests:942] reuse captured group
5774	ok 944 # SKIP [re_tests:944] unknown reason
5775	ok 945 # SKIP [re_tests:945] unknown reason
5776	ok 957 # SKIP [re_tests:957]
5777	ok 958 # SKIP [re_tests:958]
5778	not ok 959 # TODO [re_tests:959] [perl #34195]
5779	not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion
5780	ok
5781	t/compilers/pge/perl6regex/01-regex....
5782	not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&\|) - parse error
5783	not ok 99 # TODO [rx_metachars:114] null pattern invalid
5784	not ok 386 # TODO [rx_backtrack:4] basic
5785	not ok 427 # TODO [rx_charclass:26] illegal character range
5786	not ok 458 # TODO [rx_charclass:62] literal match (\")
5787	not ok 459 # TODO [rx_charclass:64] literal match (\")
5788	not ok 460 # TODO [rx_charclass:66] literal match with quote
5789	not ok 461 # TODO [rx_charclass:68] literal match with quote
5790	not ok 462 # TODO [rx_charclass:70] literal match with backslash
5791	not ok 463 # TODO [rx_charclass:72] literal match with interpolation
5792	not ok 464 # TODO [rx_charclass:74] literal match with interpolation
5793	not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i)
5794	not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s)
5795	not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s)
5796	not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s)
5797	not ok 709 # TODO [rx_modifiers:131] basic ws match
5798	not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5)
5799	not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth)
5800	not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth)
5801	ok
5802	t/compilers/pge/perl6regex/context.....
5803	not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented
5804	ok
5805	t/compilers/tge/basic..................ok
5806	t/compilers/tge/grammar................
5807	not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug
5808	ok
5809	t/compilers/tge/parser.................ok
5810	t/library/cgi_query_hash...............ok
5811	t/library/coroutine....................ok
5812	t/library/dumper.......................ok
5813	t/library/getopt_obj...................ok
5814	t/library/hllmacros....................ok
5815	t/library/iter.........................ok
5816	t/library/md5..........................ok
5817	t/library/mime_base64..................ok
5818	t/library/mt19937ar....................ok
5819	t/library/p6object.....................
5820	not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) >
5821	ok
5822	t/library/parrotlib....................ok
5823	t/library/pcre.........................
5824	ok 1 # SKIP no pcre-config
5825	ok
5826	t/library/pg...........................
5827	ok 1 # SKIP skipped
5828	ok 2 # SKIP skipped
5829	ok 3 # SKIP skipped
5830	ok 4 # SKIP skipped
5831	ok 5 # SKIP skipped
5832	ok 6 # SKIP skipped
5833	ok 7 # SKIP skipped
5834	ok 8 # SKIP skipped
5835	ok 9 # SKIP skipped
5836	ok 10 # SKIP skipped
5837	ok 11 # SKIP skipped
5838	ok 12 # SKIP skipped
5839	ok 13 # SKIP skipped
5840	ok 14 # SKIP skipped
5841	ok 15 # SKIP skipped
5842	ok 16 # SKIP skipped
5843	ok 17 # SKIP skipped
5844	ok 18 # SKIP skipped
5845	ok 19 # SKIP skipped
5846	ok 20 # SKIP skipped
5847	ok 21 # SKIP skipped
5848	ok 22 # SKIP skipped
5849	ok 23 # SKIP skipped
5850	ok 24 # SKIP skipped
5851	ok 25 # SKIP skipped
5852	ok 26 # SKIP skipped
5853	ok 27 # SKIP skipped
5854	ok 28 # SKIP skipped
5855	ok 29 # SKIP skipped
5856	ok 30 # SKIP skipped
5857	ok 31 # SKIP skipped
5858	ok 32 # SKIP skipped
5859	ok 33 # SKIP skipped
5860	ok 34 # SKIP skipped
5861	ok 35 # SKIP skipped
5862	ok 36 # SKIP skipped
5863	ok 37 # SKIP skipped
5864	ok 38 # SKIP skipped
5865	ok 39 # SKIP skipped
5866	ok 40 # SKIP skipped
5867	ok 41 # SKIP skipped
5868	ok 42 # SKIP skipped
5869	ok 43 # SKIP skipped
5870	ok
5871	t/library/protoobject..................ok
5872	t/library/rand.........................ok
5873	t/library/range........................ok
5874	t/library/streams......................
5875	ok 18 # SKIP broken method invocation
5876	ok 20 # SKIP broken method invocation
5877	ok
5878	t/library/string_utils.................ok
5879	t/library/tcl_glob.....................ok
5880	t/library/tcl_lib......................ok
5881	t/library/test_builder_tester..........ok
5882	t/library/test_class...................ok
5883	t/library/test_more....................ok
5884	t/library/uuid.........................ok
5885	t/library/yaml_dumper..................
5886	not ok 7 - properties # TODO not yet implemented
5887	not ok 8 - indent string # TODO not supported
5888	not ok 9 - back-referencing properties # TODO not yet implemented
5889	not ok 10 - self-referential properties (1) # TODO not yet implemented
5890	not ok 11 - self-referential properties (2) # TODO not yet implemented
5891	not ok 26 - custom dumper # TODO not yet implemented
5892	ok
5893	t/library/yaml_parser_syck.............
5894	not ok 1 - basic parsing # TODO Not properly implemented yet
5895	ok
5896
5897	Test Summary Report
5898	-------------------
5899	t/op/trans (Wstat: 0 Tests: 22 Failed: 0)
5900	TODO passed: 13
5901	t/compilers/pge/pge_examples (Wstat: 256 Tests: 2 Failed: 1)
5902	Failed test: 2
5903	Non-zero exit status: 1
5904	Files=252, Tests=8027, 469 wallclock secs ( 6.01 usr 4.01 sys + 187.71 cusr 103.45 csys = 301.18 CPU)
5905	Result: FAIL
5906	make[1]: *** [testj] Error 1
5907	make: [fulltest] Error 2 (ignored)

Download in other formats:

Original Format