Ticket #444: fulltest.log

File fulltest.log, 245.2 KB (added by dukeleto, 5 years ago)
Line 
1make testb \
2        testC \
3        testf \
4        testg \
5        testj \
6        testr \
7        testS \
8        src_tests \
9        run_tests \
10        perl_tests \
11        codetest \
12        benchmark_tests \
13        manifest_tests \
14        examples_tests \
15        distro_tests
16Compiling with:
17xx.c
18cc -I./include -g -pipe -fno-common -no-cpp-precomp -Wdeclaration-after-statement -I/usr/local/include -pipe -fno-common -Wno-long-double -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wbad-function-cast -Wdeclaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -g -Wno-shadow -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO -I. -o xx.o -c xx.c
19make -C docs
20perl -MExtUtils::Command -e mkpath ops
21make -C src/dynpmc
22perl -MExtUtils::Command -e cp *.bundle /Users/leto/svn/parrot/runtime/parrot/dynext
23make -C src/dynoplibs
24perl -MExtUtils::Command -e cp *.bundle /Users/leto/svn/parrot/runtime/parrot/dynext
25make -C compilers/pct
26make[2]: Nothing to be done for `all'.
27make -C compilers/pge
28make[2]: Nothing to be done for `all'.
29make -C compilers/tge
30make[2]: Nothing to be done for `all'.
31make -C compilers/nqp
32make[2]: Nothing to be done for `all'.
33make -C compilers/json
34make[2]: Nothing to be done for `all'.
35perl t/harness --gc-debug --running-make-test -b --runcore-tests
36t/compilers/imcc/imcpasm/cfg...........ok
37t/compilers/imcc/imcpasm/opt0..........
38ok 1 # SKIP disabled graph coloring register allocator, RT #57028
39ok 3 # SKIP disabled graph coloring register allocator, RT #57028
40ok
41t/compilers/imcc/imcpasm/opt1..........
42ok 76 # SKIP constant concat N/Y
43ok
44t/compilers/imcc/imcpasm/opt2..........
45ok 5 # SKIP loop opt disabled for now
46ok
47t/compilers/imcc/imcpasm/optc..........
48not ok 9 - tailcall 1 # TODO RT #57028
49ok
50t/compilers/imcc/imcpasm/pcc...........ok
51t/compilers/imcc/imcpasm/sub...........ok
52t/compilers/imcc/reg/alloc.............ok
53t/compilers/imcc/reg/spill.............ok
54t/compilers/imcc/syn/bsr...............ok
55t/compilers/imcc/syn/clash.............
56not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet
57ok
58t/compilers/imcc/syn/const.............ok
59t/compilers/imcc/syn/errors............ok
60t/compilers/imcc/syn/eval..............
61ok 1 # SKIP changed eval semantics - see t/pmc/eval.t
62ok 2 # SKIP changed eval semantics - see t/pmc/eval.t
63ok 3 # SKIP changed eval semantics - see t/pmc/eval.t
64ok 4 # SKIP changed eval semantics - see t/pmc/eval.t
65ok 5 # SKIP changed eval semantics - see t/pmc/eval.t
66ok 6 # SKIP changed eval semantics - see t/pmc/eval.t
67ok 7 # SKIP changed eval semantics - see t/pmc/eval.t
68ok
69t/compilers/imcc/syn/file..............
70ok 13 # SKIP multiple loading not speced - failing
71ok
72t/compilers/imcc/syn/hll...............ok
73t/compilers/imcc/syn/keyed.............
74ok 1 # SKIP experimental
75ok
76t/compilers/imcc/syn/labels............ok
77t/compilers/imcc/syn/macro.............
78not ok 25 - unterminated macro 2 # TODO Darwin segfault -- RT #60926
79ok
80t/compilers/imcc/syn/objects...........ok
81t/compilers/imcc/syn/op................ok
82t/compilers/imcc/syn/pasm..............ok
83t/compilers/imcc/syn/pcc...............ok
84t/compilers/imcc/syn/pod...............
85ok 4 # SKIP Closing out of pod from included files
86ok
87t/compilers/imcc/syn/regressions.......
88not ok 4 - comments between .param(RT \#46499) # TODO broken
89not ok 6 - whitespace between .param(RT \#46499) # TODO broken
90not ok 7 - off by one error message (RT \#40204) # TODO broken
91ok
92t/compilers/imcc/syn/scope.............ok
93t/compilers/imcc/syn/subflags..........
94not ok 15 # TODO :method sub not found in namespace
95ok
96t/compilers/imcc/syn/symbols...........ok
97t/compilers/imcc/syn/tail..............ok
98t/compilers/imcc/syn/veracity..........ok
99t/op/00ff-dos..........................ok
100t/op/00ff-unix.........................ok
101t/op/01-parse_ops......................ok
102t/op/64bit.............................
1031..0 # Skip 64bit INTVAL platforms only
104skipped: 64bit INTVAL platforms only
105t/op/annotate..........................ok
106t/op/arithmetics.......................
107ok 28 # SKIP No integer overflow for 32-bit INTVALs without GMP installed
108ok
109t/op/basic.............................ok
110t/op/bitwise...........................
111ok 27 # SKIP no BigInt lib found
112ok
113t/op/box...............................ok
114t/op/calling...........................
115not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all
116not ok 93 - arg mismatch with no params # TODO RT #39844
117ok
118t/op/cc_params.........................ok
119t/op/cc_state..........................
120not ok 6 - positional found, named expected # TODO cc processor state missing
121not ok 8 - G2: argument underflow: required slurpy param # TODO failing
122ok
123t/op/cmp-nonbranch.....................ok
124t/op/comp..............................ok
125t/op/copy..............................ok
126t/op/debuginfo.........................ok
127t/op/exceptions........................
128not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans
129ok
130t/op/gc................................ok
131t/op/globals...........................ok
132t/op/hacks.............................
133ok 1 # SKIP no universal SIGFPE handling
134ok 2 # SKIP no universal SIGFPE handling
135ok
136t/op/ifunless..........................ok
137t/op/integer...........................ok
138t/op/interp............................
139ok 1 # SKIP we really shouldn't run just a label - use a sub
140ok
141t/op/io................................ok
142t/op/jit...............................ok
143t/op/jitn..............................ok
144t/op/lexicals..........................
145not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented
146ok
147t/op/literal...........................ok
148t/op/load_bytecode.....................ok
149t/op/number............................ok
150t/op/pushaction........................
151not ok 7 - pushaction: error while handling error # TODO runloop shenanigans
152ok
153t/op/say...............................ok
154t/op/spawnw............................ok
155t/op/sprintf...........................
156ok 5 # SKIP parrot extension (%B)
157ok 7 # SKIP perl5-specific extension (%D)
158ok 9 # SKIP perl5-specific extension (%F)
159ok 16 # SKIP parrot extension (%H)
160ok 20 # SKIP parrot extension (%L)
161ok 23 # SKIP perl5-specific extension (%O)
162ok 24 # SKIP parrot extension (%P)
163ok 27 # SKIP parrot extension (%S)
164ok 29 # SKIP perl5-specific extension (%U)
165not ok 64 # TODO [%03.2d]  actual: > 01<
166ok 71 # SKIP perl5-specific extension (%v...)
167ok 72 # SKIP perl5-specific extension (%v...)
168ok 73 # SKIP perl5-specific extension (%v...)
169ok 74 # SKIP perl5-specific extension (%v...)
170ok 75 # SKIP perl5-specific extension (%v...)
171ok 76 # SKIP perl5-specific extension (%v...)
172ok 77 # SKIP perl5-specific extension (%v...)
173ok 78 # SKIP perl5-specific extension (%v...)
174ok 79 # SKIP perl5-specific extension (%v...)
175ok 80 # SKIP perl5-specific extension (%v...)
176ok 81 # SKIP perl5-specific extension (%v...)
177ok 82 # SKIP perl5-specific extension (%v...)
178ok 83 # SKIP perl5-specific extension (%v...)
179ok 84 # SKIP perl5-specific extension (%v...)
180ok 85 # SKIP perl5-specific extension (%v...)
181ok 86 # SKIP perl5-specific extension (%v...)
182ok 87 # SKIP perl5-specific extension (%v...)
183ok 88 # SKIP perl5-specific extension (%v...)
184ok 89 # SKIP perl5-specific extension (%v...)
185ok 90 # SKIP perl5-specific extension (%v...)
186ok 91 # SKIP perl5-specific extension (%v...)
187ok 92 # SKIP perl5-specific extension (%v...)
188ok 93 # SKIP perl5-specific extension (%v...)
189ok 94 # SKIP perl5-specific extension (%v...)
190ok 95 # SKIP perl5-specific extension (%v...)
191ok 96 # SKIP perl5-specific extension (%v...)
192ok 97 # SKIP perl5-specific extension (%v...)
193ok 98 # SKIP perl5-specific extension (%v...)
194ok 99 # SKIP perl5-specific extension (%v...)
195ok 114 # SKIP harness needs support for * modifier
196ok 131 # SKIP harness needs support for * modifier
197ok 141 # SKIP harness needs support for * modifier
198ok 144 # SKIP perl5 expresssion as test value
199not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1<
200ok 161 # SKIP harness needs support for * modifier
201ok 166 # SKIP harness needs support for * modifier
202not ok 187 # TODO [%h]  actual: ><
203not ok 191 # TODO [%l]  actual: ><
204ok 193 # SKIP perl5-specific test
205ok 200 # SKIP perl5-specific test
206ok 201 # SKIP perl5-specific test
207ok 202 # SKIP parrot extension (%p)
208ok 204 # SKIP parrot extension (%r)
209ok 210 # SKIP harness needs support for * modifier
210ok 214 # SKIP harness needs support for * modifier
211not ok 223 # TODO [%v]  actual: ><
212ok 233 # SKIP harness needs support for * modifier
213ok 234 # SKIP perl5-specific extension (%v...)
214ok 235 # SKIP perl5-specific extension (%v...)
215ok 238 # SKIP perl5-specific test
216ok 239 # SKIP perl5-specific test
217ok 240 # SKIP perl5-specific test
218ok 241 # SKIP perl5-specific test
219ok 242 # SKIP perl5-specific test
220ok 243 # SKIP perl5-specific test
221ok 244 # SKIP perl5-specific test
222ok 245 # SKIP perl5-specific test
223ok 246 # SKIP perl5-specific test
224ok 247 # SKIP perl5-specific test
225ok 248 # SKIP perl5-specific test
226ok 249 # SKIP perl5-specific test
227ok 250 # SKIP perl5-specific test
228ok 251 # SKIP perl5-specific test
229ok 252 # SKIP perl5-specific extension (%v...)
230ok 253 # SKIP perl5-specific extension (%v...)
231ok 254 # SKIP perl5-specific extension (%v...)
232ok 255 # SKIP perl5-specific extension (%v...)
233ok 256 # SKIP perl5-specific extension (%v...)
234ok 257 # SKIP perl5-specific extension (%v...)
235ok 258 # SKIP perl5-specific extension (%v...)
236ok 259 # SKIP perl5-specific extension (%v...)
237ok 260 # SKIP perl5-specific extension (%v...)
238ok 261 # SKIP perl5-specific extension (%v...)
239ok 262 # SKIP perl5-specific extension (%v...)
240ok 263 # SKIP perl5-specific extension (%v...)
241ok 264 # SKIP perl5-specific extension (%v...)
242ok 265 # SKIP perl5-specific extension (%v...)
243ok 266 # SKIP perl5-specific extension (%v...)
244ok 267 # SKIP perl5-specific extension (%v...)
245ok 268 # SKIP perl5-specific extension (%v...)
246ok 269 # SKIP perl5-specific extension (%v...)
247ok 270 # SKIP perl5-specific extension (%v...)
248ok 271 # SKIP perl5-specific extension (%v...)
249ok 272 # SKIP perl5-specific extension (%v...)
250ok 273 # SKIP perl5-specific extension (%v...)
251ok 274 # SKIP perl5-specific extension (%v...)
252ok 275 # SKIP perl5-specific extension (%v...)
253ok 276 # SKIP perl5-specific extension (%v...)
254ok 277 # SKIP perl5-specific extension (%v...)
255ok 278 # SKIP perl5-specific extension (%v...)
256ok 279 # SKIP perl5-specific extension (%v...)
257ok 280 # SKIP perl5-specific extension (%v...)
258ok 281 # SKIP perl5-specific extension (%v...)
259ok 282 # SKIP perl5-specific extension (%v...)
260ok 283 # SKIP perl5-specific extension (%v...)
261ok 284 # SKIP perl5-specific extension (%v...)
262ok 285 # SKIP perl5-specific extension (%v...)
263ok 286 # SKIP perl5-specific extension (%v...)
264ok 287 # SKIP perl5-specific extension (%v...)
265ok 288 # SKIP perl5-specific extension (%v...)
266ok 289 # SKIP perl5-specific extension (%v...)
267ok 290 # SKIP perl5-specific extension (%v...)
268ok 291 # SKIP perl5-specific extension (%v...)
269ok 292 # SKIP perl5-specific extension (%v...)
270ok 293 # SKIP perl5-specific extension (%v...)
271ok 294 # SKIP perl5-specific extension (%v...)
272ok 295 # SKIP perl5-specific extension (%v...)
273ok 296 # SKIP perl5-specific extension (%v...)
274ok 297 # SKIP perl5-specific extension (%v...)
275ok 298 # SKIP perl5-specific extension (%v...)
276ok 300 # SKIP harness needs support for * modifier
277not ok 304 # TODO [%#b]  actual: >0b0<
278not ok 305 # TODO [%#o]  actual: >00<
279not ok 306 # TODO [%#x]  actual: >0x0<
280ok 307 # SKIP perl5-specific extension (%v...)
281ok 308 # SKIP perl5-specific extension (%v...)
282ok
283t/op/sprintf2..........................ok
284t/op/string............................
285ok 103 # SKIP Pending rework of creating non-ascii literals
286ok 104 # SKIP Pending rework of creating non-ascii literals
287ok 118 # SKIP Pending reimplementation of find_encoding
288ok 119 # SKIP no more visible encoding
289ok 137 # SKIP No unicode yet
290ok 139 # SKIP no more transcode
291ok 140 # SKIP no more chartype
292ok
293t/op/string_cclass.....................
294ok 7 # SKIP unicode support unavailable
295ok 8 # SKIP unicode support unavailable
296ok 9 # SKIP unicode support unavailable
297ok
298t/op/string_cs.........................
299ok 31 # SKIP no ICU lib
300ok 32 # SKIP no ICU lib
301ok 33 # SKIP no ICU lib
302ok 34 # SKIP no ICU lib
303ok 35 # SKIP no ICU lib
304ok 36 # SKIP no ICU lib
305ok 37 # SKIP no ICU lib
306ok 38 # SKIP no ICU lib
307ok 39 # SKIP no ICU lib
308ok 40 # SKIP no ICU lib
309ok 41 # SKIP no ICU lib
310ok 42 # SKIP no ICU lib
311ok 43 # SKIP no ICU lib
312ok 44 # SKIP no ICU lib
313ok 45 # SKIP no ICU lib
314ok 46 # SKIP no ICU lib
315ok
316t/op/string_mem........................ok
317t/op/stringu...........................
318ok 20 # SKIP no ICU lib
319ok 21 # SKIP no ICU lib
320ok 22 # SKIP no ICU lib
321ok 25 # SKIP Tests seem to fail on big endian machines with icu
322ok 26 # SKIP Tests seem to fail on big endian machines with icu
323not ok 27 - UTF-8 and Unicode literals # TODO TT #24
324ok
325t/op/sysinfo...........................
326not ok 11 - sysinfo OS version string # TODO Not Currently Implemented
327not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented
328ok 13 # SKIP Requires a lot of work to find out the correct answer
329ok 14 # SKIP Testing only in some known platforms
330ok
331t/op/time..............................ok
332t/op/trans.............................ok
333t/pmc/addrregistry.....................ok
334t/pmc/array............................
335not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken
336ok
337t/pmc/bigint...........................
3381..0 # Skip No BigInt Lib configured
339skipped: No BigInt Lib configured
340t/pmc/bignum...........................
3411..0 # Skip No BigNum PMC enabled
342skipped: No BigNum PMC enabled
343t/pmc/boolean..........................ok
344t/pmc/bound_nci........................ok
345t/pmc/callsignature....................ok
346t/pmc/capture..........................ok
347t/pmc/class............................
348not ok 28 # TODO add_method() invoking method added to class works
349ok
350t/pmc/codestring.......................ok
351t/pmc/complex..........................
352ok 58 # SKIP div by zero not caught
353ok 59 # SKIP div by zero not caught
354ok 60 # SKIP div by zero not caught
355ok 86 # SKIP instantiate n/y
356ok 87 # SKIP instantiate n/y
357ok 88 # SKIP instantiate n/y
358ok 89 # SKIP instantiate n/y
359ok 126 # SKIP inf is not platform-independent
360ok 465 # SKIP add using subclass of Complex - RT #59630
361ok 466 # SKIP add using subclass of Complex - RT #59630
362ok 467 # SKIP add using subclass of Complex - RT #59630
363ok
364t/pmc/config...........................ok
365t/pmc/continuation.....................ok
366t/pmc/coroutine........................
367not ok 9 - Call an exited coroutine # TODO goes one iteration too far.
368ok
369t/pmc/cpointer.........................ok
370t/pmc/default..........................
371not ok 1 - new # TODO not implemeted
372ok
373t/pmc/env..............................ok
374t/pmc/eval.............................ok
375t/pmc/eventhandler.....................ok
376t/pmc/exception........................
377not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans
378not ok 25 - pushaction: error while handling error # TODO runloop shenanigans
379not ok 27 - invoke handler in calling sub # TODO deprecate rethrow
380not ok 30 - catch ex from C-level MULTI function # TODO broken
381ok
382t/pmc/exceptionhandler.................ok
383t/pmc/exporter.........................ok
384t/pmc/file.............................ok
385t/pmc/filehandle.......................
386ok 3 # SKIP no asynch calls yet
387not ok 8 - record_separator # TODO not yet implemented
388ok
389t/pmc/fixedbooleanarray................ok
390t/pmc/fixedfloatarray..................ok
391t/pmc/fixedintegerarray................ok
392t/pmc/fixedpmcarray....................ok
393t/pmc/fixedstringarray.................ok
394t/pmc/float............................ok
395t/pmc/freeze...........................ok
396t/pmc/globals..........................ok
397t/pmc/hash.............................ok
398t/pmc/integer..........................ok
399t/pmc/io...............................
400not ok 1 - IO on some invalid types # TODO IO on some invalid types
401ok 8 # SKIP clone not finished yet
402not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433
403not ok 40 - string read/write handle # TODO no stringhandle yet
404ok
405t/pmc/io_iterator......................
406not ok 1 - new # TODO not yet implemented
407not ok 2 - shift # TODO not yet implemented
408not ok 3 - get_bool (vtable) # TODO not yet implemented
409ok
410t/pmc/io_status........................
411not ok 1 - new # TODO not yet implemented
412not ok 2 - get_integer (vtable) # TODO not yet implemented
413not ok 3 - get_bool (vtable) # TODO not yet implemented
414not ok 4 - return # TODO not yet implemented
415not ok 5 - error # TODO not yet implemented
416not ok 6 - throw # TODO not yet implemented
417ok
418t/pmc/iterator.........................
419ok 13 # SKIP N/Y: length of rest of array
420not ok 16 - adding keys during iteration # TODO adding keys during iteration
421not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points'
422ok
423t/pmc/key..............................
424not ok 10 # TODO register and non-register string keys should be COW (RT #60128)
425ok
426t/pmc/lexinfo..........................ok
427t/pmc/lexpad...........................ok
428t/pmc/managedstruct....................ok
429t/pmc/multidispatch....................
430not ok 22 - MMD on PMC types - Any # TODO RT #41374
431not ok 25 - add as method - inherited # TODO RT #41374
432not ok 32 - use a core func for an object # TODO RT #59628
433ok
434t/pmc/multisub.........................ok
435t/pmc/namespace........................
436not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17
437ok
438t/pmc/nci..............................ok
439t/pmc/null.............................ok
440t/pmc/object-meths.....................
441ok 14 # SKIP currently broken
442ok 25 # SKIP no bound NCI method
443ok
444t/pmc/object-mro.......................ok
445t/pmc/object...........................ok
446t/pmc/objects..........................ok
447t/pmc/orderedhash......................ok
448t/pmc/os...............................ok
449t/pmc/packfile.........................ok
450t/pmc/packfileconstanttable............
451not ok 3 - get_type, get_*_keyed_int # TODO See TT #385.
452ok
453t/pmc/packfiledirectory................ok
454t/pmc/packfilefixupentry...............ok
455t/pmc/packfilefixuptable...............ok
456t/pmc/packfilerawsegment...............ok
457t/pmc/packfilesegment..................ok
458t/pmc/parrotclass......................ok
459t/pmc/parrotinterpreter................ok
460t/pmc/parrotio.........................
461not ok 2 - open and close - synchronous # TODO not yet implemented
462ok 3 # SKIP no asynch calls yet
463not ok 4 - print, read, and readline - synchronous # TODO not yet implemented
464not ok 5 - record_separator # TODO not yet implemented
465not ok 6 - buffer_type # TODO not yet implemented
466ok
467t/pmc/parrotlibrary....................ok
468t/pmc/parrotobject.....................ok
469t/pmc/parrotrunningthread..............ok
470t/pmc/parrotthread.....................ok
471t/pmc/pccmethod_test...................ok
472t/pmc/pmc..............................ok
473t/pmc/pmcproxy.........................ok
474t/pmc/pointer..........................ok
475t/pmc/prop.............................ok
476t/pmc/random...........................ok
477t/pmc/ref..............................ok
478t/pmc/resizablebooleanarray............ok
479t/pmc/resizablefloatarray..............ok
480t/pmc/resizableintegerarray............ok
481t/pmc/resizablepmcarray................ok
482t/pmc/resizablestringarray.............ok
483t/pmc/retcontinuation..................ok
484t/pmc/ro...............................
485not ok 8 - ResizablePMCArray -- Recursive # TODO 1
486ok
487t/pmc/role.............................ok
488t/pmc/scalar...........................
489ok 1 # SKIP doesn't work yet
490ok
491t/pmc/scheduler........................ok
492t/pmc/schedulermessage.................ok
493t/pmc/sharedref........................ok
494t/pmc/signal...........................
4951..0 # Skip Signals currently disabled
496skipped: Signals currently disabled
497t/pmc/slice............................
498not ok 2 - bug with slice bits # TODO parser
499ok
500t/pmc/string...........................ok
501t/pmc/stringhandle.....................
502ok 3 # SKIP no asynch calls yet
503not ok 9 - record_separator # TODO not yet implemented
504ok
505t/pmc/sub..............................ok
506t/pmc/sys..............................ok
507t/pmc/task.............................ok
508t/pmc/threads..........................
509not ok 11 - CLONE_CODE | CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511
510not ok 15 - CLONE_CODE|CLONE_GLOBALS|CLONE_HLL|CLONE_LIBRARIES # TODO RT #41373
511ok
512t/pmc/timer............................ok
513t/pmc/undef............................ok
514t/pmc/unmanagedstruct..................ok
515t/oo/attributes........................ok
516t/oo/composition.......................ok
517t/oo/inheritance.......................ok
518t/oo/isa...............................ok
519t/oo/metamodel.........................
520not ok 6 # TODO tail attribute has a type
521not ok 12 # TODO new opcode makes working objects
522ok
523t/oo/methods...........................ok
524t/oo/mro-c3............................ok
525t/oo/names.............................ok
526t/oo/new...............................ok
527t/oo/ops...............................ok
528t/oo/proxy.............................ok
529t/oo/subclass..........................ok
530t/oo/vtableoverride....................ok
531t/native_pbc/header....................
5321..0 # Skip pending robust testing strategy, TT #357
533skipped: pending robust testing strategy, TT #357
534t/native_pbc/integer...................
5351..0 # Skip pending robust testing strategy, TT #357
536skipped: pending robust testing strategy, TT #357
537t/native_pbc/number....................
5381..0 # Skip pending robust testing strategy, TT #357
539skipped: pending robust testing strategy, TT #357
540t/native_pbc/string....................
5411..0 # Skip pending robust testing strategy, TT #357
542skipped: pending robust testing strategy, TT #357
543t/dynpmc/dynlexpad.....................
544not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads
545ok
546t/dynpmc/foo...........................
547ok 6 # SKIP No BigInt Lib configured
548ok
549t/dynpmc/gdbmhash......................
5501..0 # Skip No gdbm library available
551skipped: No gdbm library available
552t/dynpmc/md2...........................ok
553t/dynpmc/md4...........................ok
554t/dynpmc/md5...........................ok
555t/dynpmc/pair..........................ok
556t/dynpmc/rational......................ok
557t/dynpmc/ripemd160.....................ok
558t/dynpmc/rotest........................ok
559t/dynpmc/sha...........................ok
560t/dynpmc/sha1..........................ok
561t/dynpmc/sha256........................
5621..0 # Skip Too old library
563skipped: Too old library
564t/dynpmc/sha512........................
5651..0 # Skip Too old library
566skipped: Too old library
567t/dynpmc/subclass_with_pir_method......
568not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces
569not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces
570ok
571t/dynpmc/subproxy......................ok
572t/dynoplibs/dan........................ok
573t/dynoplibs/myops......................ok
574t/compilers/pct/complete_workflow......ok
575t/compilers/pct/past...................ok
576t/compilers/pct/pct_hllcompiler........ok
577t/compilers/pct/post...................ok
578t/compilers/pge/00-basic...............ok
579t/compilers/pge/02-match...............ok
580t/compilers/pge/03-optable.............ok
581t/compilers/pge/04-compile.............ok
582t/compilers/pge/06-grammar.............ok
583t/compilers/pge/pge-hs.................ok
584t/compilers/pge/pge....................ok
585t/compilers/pge/pge_examples...........ok
586t/compilers/pge/pge_globs..............ok
587t/compilers/pge/pge_text...............ok
588t/compilers/pge/pge_util...............ok
589t/compilers/pge/p5regex/p5rx...........
590not ok 116 # TODO [re_tests:116] character class in enumeration
591not ok 119 # TODO [re_tests:119] character class in enumeration
592not ok 120 # TODO [re_tests:120] character class in enumeration
593not ok 123 # TODO [re_tests:123] character class in enumeration
594not ok 124 # TODO [re_tests:124] character class in enumeration
595not ok 127 # TODO [re_tests:127] character class in enumeration
596ok 138 # SKIP [re_tests:138] parser bug
597ok 139 # SKIP [re_tests:139] broken col 4?
598ok 143 # SKIP [re_tests:143] bug or error
599ok 144 # SKIP [re_tests:144] bug or error
600ok 148 # SKIP [re_tests:148] bug or error
601ok 149 # SKIP [re_tests:149] bug or error
602ok 155 # SKIP [re_tests:155] bug or error
603ok 167 # SKIP [re_tests:167] bug or error
604not ok 234 # TODO [re_tests:234] unknown reason
605not ok 235 # TODO [re_tests:235] unknown reason
606not ok 236 # TODO [re_tests:236] unknown reason
607not ok 246 # TODO [re_tests:246] unknown reason
608not ok 247 # TODO [re_tests:247] unknown reason
609ok 248 # SKIP [re_tests:248] bug or error
610ok 249 # SKIP [re_tests:249] bug or error
611ok 252 # SKIP [re_tests:252] bug or error
612not ok 254 # TODO [re_tests:254] unknown reason
613not ok 256 # TODO [re_tests:256] unknown reason
614not ok 257 # TODO [re_tests:257] unknown reason
615ok 264 # SKIP [re_tests:264] trailing modifiers
616ok 265 # SKIP [re_tests:265] trailing modifiers
617ok 266 # SKIP [re_tests:266] trailing modifiers
618ok 267 # SKIP [re_tests:267] trailing modifiers
619ok 268 # SKIP [re_tests:268] trailing modifiers
620ok 269 # SKIP [re_tests:269] trailing modifiers
621ok 270 # SKIP [re_tests:270] trailing modifiers
622ok 271 # SKIP [re_tests:271] trailing modifiers
623ok 272 # SKIP [re_tests:272] trailing modifiers
624ok 273 # SKIP [re_tests:273] trailing modifiers
625ok 274 # SKIP [re_tests:274] trailing modifiers
626ok 275 # SKIP [re_tests:275] trailing modifiers
627ok 276 # SKIP [re_tests:276] trailing modifiers
628ok 277 # SKIP [re_tests:277] trailing modifiers
629ok 278 # SKIP [re_tests:278] trailing modifiers
630ok 279 # SKIP [re_tests:279] trailing modifiers
631ok 280 # SKIP [re_tests:280] trailing modifiers
632ok 281 # SKIP [re_tests:281] trailing modifiers
633ok 282 # SKIP [re_tests:282] trailing modifiers
634ok 283 # SKIP [re_tests:283] trailing modifiers
635ok 284 # SKIP [re_tests:284] trailing modifiers
636ok 285 # SKIP [re_tests:285] trailing modifiers
637ok 286 # SKIP [re_tests:286] trailing modifiers
638ok 287 # SKIP [re_tests:287] trailing modifiers
639ok 288 # SKIP [re_tests:288] trailing modifiers
640ok 289 # SKIP [re_tests:289] trailing modifiers
641ok 290 # SKIP [re_tests:290] trailing modifiers
642ok 291 # SKIP [re_tests:291] trailing modifiers
643ok 292 # SKIP [re_tests:292] trailing modifiers
644ok 293 # SKIP [re_tests:293] trailing modifiers
645ok 294 # SKIP [re_tests:294] trailing modifiers
646ok 295 # SKIP [re_tests:295] trailing modifiers
647ok 296 # SKIP [re_tests:296] trailing modifiers
648ok 297 # SKIP [re_tests:297] trailing modifiers
649ok 298 # SKIP [re_tests:298] trailing modifiers
650ok 299 # SKIP [re_tests:299] trailing modifiers
651ok 300 # SKIP [re_tests:300] trailing modifiers
652ok 301 # SKIP [re_tests:301] trailing modifiers
653ok 302 # SKIP [re_tests:302] trailing modifiers
654ok 303 # SKIP [re_tests:303] trailing modifiers
655ok 304 # SKIP [re_tests:304] trailing modifiers
656ok 305 # SKIP [re_tests:305] trailing modifiers
657ok 306 # SKIP [re_tests:306] trailing modifiers
658ok 307 # SKIP [re_tests:307] trailing modifiers
659ok 308 # SKIP [re_tests:308] bug or error
660ok 309 # SKIP [re_tests:309] bug or error
661ok 310 # SKIP [re_tests:310] bug or error
662ok 311 # SKIP [re_tests:311] trailing modifiers
663ok 312 # SKIP [re_tests:312] trailing modifiers
664ok 313 # SKIP [re_tests:313] trailing modifiers
665ok 314 # SKIP [re_tests:314] trailing modifiers
666ok 315 # SKIP [re_tests:315] trailing modifiers
667ok 316 # SKIP [re_tests:316] trailing modifiers
668ok 317 # SKIP [re_tests:317] trailing modifiers
669ok 318 # SKIP [re_tests:318] trailing modifiers
670ok 319 # SKIP [re_tests:319] trailing modifiers
671ok 320 # SKIP [re_tests:320] trailing modifiers
672ok 321 # SKIP [re_tests:321] trailing modifiers
673ok 322 # SKIP [re_tests:322] bug or error
674ok 323 # SKIP [re_tests:323] bug or error
675ok 324 # SKIP [re_tests:324] trailing modifiers
676ok 325 # SKIP [re_tests:325] bug or error
677ok 326 # SKIP [re_tests:326] trailing modifiers
678ok 327 # SKIP [re_tests:327] trailing modifiers
679ok 328 # SKIP [re_tests:328] trailing modifiers
680ok 329 # SKIP [re_tests:329] trailing modifiers
681ok 330 # SKIP [re_tests:330] bug or error
682ok 331 # SKIP [re_tests:331] bug or error
683ok 332 # SKIP [re_tests:332] trailing modifiers
684ok 333 # SKIP [re_tests:333] trailing modifiers
685ok 334 # SKIP [re_tests:334] trailing modifiers
686ok 335 # SKIP [re_tests:335] trailing modifiers
687ok 336 # SKIP [re_tests:336] bug or error
688ok 337 # SKIP [re_tests:337] trailing modifiers
689ok 338 # SKIP [re_tests:338] trailing modifiers
690ok 339 # SKIP [re_tests:339] trailing modifiers
691ok 340 # SKIP [re_tests:340] trailing modifiers
692ok 341 # SKIP [re_tests:341] trailing modifiers
693ok 342 # SKIP [re_tests:342] trailing modifiers
694ok 343 # SKIP [re_tests:343] trailing modifiers
695ok 344 # SKIP [re_tests:344] trailing modifiers
696ok 345 # SKIP [re_tests:345] trailing modifiers
697ok 346 # SKIP [re_tests:346] trailing modifiers
698ok 347 # SKIP [re_tests:347] bug or error
699ok 348 # SKIP [re_tests:348] trailing modifiers
700ok 349 # SKIP [re_tests:349] trailing modifiers
701ok 350 # SKIP [re_tests:350] trailing modifiers
702ok 351 # SKIP [re_tests:351] trailing modifiers
703ok 352 # SKIP [re_tests:352] trailing modifiers
704ok 353 # SKIP [re_tests:353] trailing modifiers
705ok 354 # SKIP [re_tests:354] trailing modifiers
706ok 355 # SKIP [re_tests:355] trailing modifiers
707ok 356 # SKIP [re_tests:356] trailing modifiers
708ok 357 # SKIP [re_tests:357] trailing modifiers
709ok 358 # SKIP [re_tests:358] trailing modifiers
710ok 359 # SKIP [re_tests:359] trailing modifiers
711ok 360 # SKIP [re_tests:360] trailing modifiers
712ok 361 # SKIP [re_tests:361] trailing modifiers
713ok 362 # SKIP [re_tests:362] trailing modifiers
714ok 363 # SKIP [re_tests:363] trailing modifiers
715ok 364 # SKIP [re_tests:364] trailing modifiers
716ok 365 # SKIP [re_tests:365] trailing modifiers
717ok 366 # SKIP [re_tests:366] trailing modifiers
718ok 367 # SKIP [re_tests:367] trailing modifiers
719ok 368 # SKIP [re_tests:368] trailing modifiers
720ok 369 # SKIP [re_tests:369] trailing modifiers
721ok 370 # SKIP [re_tests:370] trailing modifiers
722ok 371 # SKIP [re_tests:371] trailing modifiers
723ok 372 # SKIP [re_tests:372] trailing modifiers
724ok 373 # SKIP [re_tests:373] trailing modifiers
725ok 374 # SKIP [re_tests:374] trailing modifiers
726ok 375 # SKIP [re_tests:375] trailing modifiers
727ok 376 # SKIP [re_tests:376] trailing modifiers
728ok 377 # SKIP [re_tests:377] trailing modifiers
729ok 378 # SKIP [re_tests:378] trailing modifiers
730ok 379 # SKIP [re_tests:379] trailing modifiers
731ok 380 # SKIP [re_tests:380] trailing modifiers
732ok 381 # SKIP [re_tests:381] trailing modifiers
733ok 382 # SKIP [re_tests:382] trailing modifiers
734ok 383 # SKIP [re_tests:383] trailing modifiers
735ok 384 # SKIP [re_tests:384] trailing modifiers
736ok 385 # SKIP [re_tests:385] trailing modifiers
737ok 386 # SKIP [re_tests:386] trailing modifiers
738ok 387 # SKIP [re_tests:387] trailing modifiers
739ok 388 # SKIP [re_tests:388] trailing modifiers
740ok 389 # SKIP [re_tests:389] trailing modifiers
741ok 390 # SKIP [re_tests:390] trailing modifiers
742ok 391 # SKIP [re_tests:391] trailing modifiers
743ok 392 # SKIP [re_tests:392] trailing modifiers
744ok 393 # SKIP [re_tests:393] trailing modifiers
745ok 394 # SKIP [re_tests:394] trailing modifiers
746ok 395 # SKIP [re_tests:395] trailing modifiers
747not ok 396 # TODO [re_tests:396] unknown reason
748not ok 397 # TODO [re_tests:397] unknown reason
749not ok 398 # TODO [re_tests:398] unknown reason
750ok 408 # SKIP [re_tests:408] bug or error
751not ok 419 # TODO [re_tests:419] unknown reason
752not ok 422 # TODO [re_tests:422] unknown reason
753not ok 429 # TODO [re_tests:429] unknown reason
754not ok 432 # TODO [re_tests:432] unknown reason
755not ok 434 # TODO [re_tests:434] unknown reason
756not ok 435 # TODO [re_tests:435] unknown reason
757ok 436 # SKIP [re_tests:436] bug or error
758not ok 439 # TODO [re_tests:439] unknown reason
759not ok 446 # TODO [re_tests:446] unknown reason
760not ok 447 # TODO [re_tests:447] unknown reason
761not ok 448 # TODO [re_tests:448] unknown reason
762not ok 449 # TODO [re_tests:449] unknown reason
763not ok 452 # TODO [re_tests:452] unknown reason
764not ok 453 # TODO [re_tests:453] unknown reason
765not ok 454 # TODO [re_tests:454] unknown reason
766not ok 455 # TODO [re_tests:455] unknown reason
767ok 458 # SKIP [re_tests:458] unknown reason
768ok 459 # SKIP [re_tests:459] unknown reason
769ok 460 # SKIP [re_tests:460] unknown reason
770ok 461 # SKIP [re_tests:461] unknown reason
771ok 462 # SKIP [re_tests:462] unknown reason
772ok 463 # SKIP [re_tests:463] unknown reason
773ok 464 # SKIP [re_tests:464] unknown reason
774ok 465 # SKIP [re_tests:465] unknown reason
775ok 466 # SKIP [re_tests:466] unknown reason
776ok 467 # SKIP [re_tests:467] unknown reason
777ok 468 # SKIP [re_tests:468] unknown reason
778ok 469 # SKIP [re_tests:469] unknown reason
779ok 470 # SKIP [re_tests:470] unknown reason
780ok 471 # SKIP [re_tests:471] unknown reason
781ok 472 # SKIP [re_tests:472] unknown reason
782ok 473 # SKIP [re_tests:473] unknown reason
783ok 474 # SKIP [re_tests:474] unknown reason
784ok 475 # SKIP [re_tests:475] unknown reason
785ok 476 # SKIP [re_tests:476] unknown reason
786ok 477 # SKIP [re_tests:477] unknown reason
787ok 478 # SKIP [re_tests:478] unknown reason
788ok 479 # SKIP [re_tests:479] unknown reason
789ok 480 # SKIP [re_tests:480] unknown reason
790ok 483 # SKIP [re_tests:483]
791ok 484 # SKIP [re_tests:484]
792ok 487 # SKIP [re_tests:487] bug or error
793ok 488 # SKIP [re_tests:488] bug or error
794ok 489 # SKIP [re_tests:489] bug or error
795ok 490 # SKIP [re_tests:490] bug or error
796ok 491 # SKIP [re_tests:491] kills a parrot
797ok 492 # SKIP [re_tests:492] bug or error
798ok 493 # SKIP [re_tests:493] kills a parrot
799not ok 495 # TODO [re_tests:495] unknown reason
800ok 496 # SKIP [re_tests:496]
801not ok 498 # TODO [re_tests:498] unknown reason
802not ok 500 # TODO [re_tests:500] unknown reason
803not ok 501 # TODO [re_tests:501] unknown reason
804ok 502 # SKIP [re_tests:502] unknown reason
805not ok 503 # TODO [re_tests:503] unknown reason
806not ok 504 # TODO [re_tests:504] unknown reason
807not ok 505 # TODO [re_tests:505] unknown reason
808not ok 506 # TODO [re_tests:506] unknown reason
809not ok 507 # TODO [re_tests:507] unknown reason
810not ok 508 # TODO [re_tests:508] unknown reason
811not ok 509 # TODO [re_tests:509] unknown reason
812not ok 510 # TODO [re_tests:510] unknown reason
813not ok 511 # TODO [re_tests:511] unknown reason
814not ok 512 # TODO [re_tests:512] unknown reason
815not ok 515 # TODO [re_tests:515] unknown reason
816not ok 521 # TODO [re_tests:521] unknown reason
817not ok 522 # TODO [re_tests:522] unknown reason
818not ok 523 # TODO [re_tests:523] unknown reason
819not ok 524 # TODO [re_tests:524] unknown reason
820not ok 527 # TODO [re_tests:527] unknown reason
821not ok 528 # TODO [re_tests:528] unknown reason
822ok 531 # SKIP [re_tests:531] bug or error
823ok 532 # SKIP [re_tests:532] bug or error
824not ok 535 # TODO [re_tests:535] unknown reason
825not ok 536 # TODO [re_tests:536] unknown reason
826not ok 539 # TODO [re_tests:539] unknown reason
827not ok 540 # TODO [re_tests:540] unknown reason
828not ok 541 # TODO [re_tests:541] unknown reason
829not ok 544 # TODO [re_tests:544] unknown reason
830not ok 545 # TODO [re_tests:545] unknown reason
831ok 556 # SKIP [re_tests:556] kills a parrot
832ok 557 # SKIP [re_tests:557] kills a parrot
833not ok 559 # TODO [re_tests:559] unknown reason
834ok 563 # SKIP [re_tests:563] bug or error
835ok 564 # SKIP [re_tests:564] bug or error
836ok 566 # SKIP [re_tests:566] bug or error
837ok 568 # SKIP [re_tests:568] kills a parrot
838ok 569 # SKIP [re_tests:569] kills a parrot
839ok 570 # SKIP [re_tests:570] kills a parrot
840ok 571 # SKIP [re_tests:571] kills a parrot
841ok 572 # SKIP [re_tests:572] kills a parrot
842ok 573 # SKIP [re_tests:573] kills a parrot
843ok 574 # SKIP [re_tests:574] kills a parrot
844ok 575 # SKIP [re_tests:575] kills a parrot
845ok 576 # SKIP [re_tests:576] kills a parrot
846ok 577 # SKIP [re_tests:577] kills a parrot
847ok 578 # SKIP [re_tests:578] kills a parrot
848ok 579 # SKIP [re_tests:579] kills a parrot
849ok 580 # SKIP [re_tests:580] kills a parrot
850ok 581 # SKIP [re_tests:581] kills a parrot
851ok 582 # SKIP [re_tests:582] kills a parrot
852ok 583 # SKIP [re_tests:583] kills a parrot
853ok 584 # SKIP [re_tests:584] kills a parrot
854ok 585 # SKIP [re_tests:585] kills a parrot
855ok 586 # SKIP [re_tests:586] kills a parrot
856ok 587 # SKIP [re_tests:587] kills a parrot
857ok 588 # SKIP [re_tests:588] kills a parrot
858ok 589 # SKIP [re_tests:589] kills a parrot
859ok 590 # SKIP [re_tests:590] kills a parrot
860ok 591 # SKIP [re_tests:591] kills a parrot
861ok 592 # SKIP [re_tests:592] kills a parrot
862ok 593 # SKIP [re_tests:593] bug or error
863ok 594 # SKIP [re_tests:594] bug or error
864not ok 595 # TODO [re_tests:595] unknown reason
865not ok 596 # TODO [re_tests:596] unknown reason
866ok 597 # SKIP [re_tests:597] unknown reason
867ok 598 # SKIP [re_tests:598] bug or error
868ok 599 # SKIP [re_tests:599] bug or error
869not ok 600 # TODO [re_tests:600] unknown reason
870not ok 601 # TODO [re_tests:601] unknown reason
871not ok 603 # TODO [re_tests:603] unknown reason
872not ok 604 # TODO [re_tests:604] unknown reason
873not ok 606 # TODO [re_tests:606] unknown reason
874not ok 607 # TODO [re_tests:607] unknown reason
875ok 609 # SKIP [re_tests:609] unknown reason
876ok 610 # SKIP [re_tests:610] unknown reason
877ok 611 # SKIP [re_tests:611] unknown reason
878ok 612 # SKIP [re_tests:612] unknown reason
879ok 613 # SKIP [re_tests:613] unknown reason
880ok 614 # SKIP [re_tests:614] unknown reason
881ok 615 # SKIP [re_tests:615] unknown reason
882ok 616 # SKIP [re_tests:616] unknown reason
883ok 617 # SKIP [re_tests:617] unknown reason
884not ok 621 # TODO [re_tests:621] unknown reason
885not ok 623 # TODO [re_tests:623] unknown reason
886not ok 624 # TODO [re_tests:624] unknown reason
887not ok 625 # TODO [re_tests:625] unknown reason
888ok 627 # SKIP [re_tests:627] unknown reason
889ok 628 # SKIP [re_tests:628] unknown reason
890ok 629 # SKIP [re_tests:629] unknown reason
891ok 630 # SKIP [re_tests:630] unknown reason
892ok 631 # SKIP [re_tests:631] unknown reason
893ok 632 # SKIP [re_tests:632] unknown reason
894ok 633 # SKIP [re_tests:633] unknown reason
895ok 634 # SKIP [re_tests:634] unknown reason
896ok 635 # SKIP [re_tests:635] unknown reason
897not ok 639 # TODO [re_tests:639] unknown reason
898not ok 641 # TODO [re_tests:641] unknown reason
899not ok 642 # TODO [re_tests:642] unknown reason
900not ok 643 # TODO [re_tests:643] unknown reason
901ok 645 # SKIP [re_tests:645] unknown reason
902ok 646 # SKIP [re_tests:646] unknown reason
903ok 647 # SKIP [re_tests:647] unknown reason
904ok 648 # SKIP [re_tests:648] unknown reason
905ok 649 # SKIP [re_tests:649] unknown reason
906ok 650 # SKIP [re_tests:650] unknown reason
907ok 651 # SKIP [re_tests:651] unknown reason
908ok 652 # SKIP [re_tests:652] unknown reason
909ok 653 # SKIP [re_tests:653] unknown reason
910ok 663 # SKIP [re_tests:663] unknown reason
911ok 664 # SKIP [re_tests:664] unknown reason
912ok 665 # SKIP [re_tests:665] unknown reason
913ok 666 # SKIP [re_tests:666] unknown reason
914ok 667 # SKIP [re_tests:667] unknown reason
915ok 668 # SKIP [re_tests:668] unknown reason
916ok 669 # SKIP [re_tests:669] unknown reason
917ok 670 # SKIP [re_tests:670] unknown reason
918ok 671 # SKIP [re_tests:671] unknown reason
919ok 681 # SKIP [re_tests:681] unknown reason
920ok 682 # SKIP [re_tests:682] unknown reason
921ok 683 # SKIP [re_tests:683] unknown reason
922ok 684 # SKIP [re_tests:684] unknown reason
923ok 685 # SKIP [re_tests:685] unknown reason
924ok 686 # SKIP [re_tests:686] unknown reason
925ok 687 # SKIP [re_tests:687] unknown reason
926ok 688 # SKIP [re_tests:688] unknown reason
927ok 689 # SKIP [re_tests:689] unknown reason
928not ok 693 # TODO [re_tests:693] unknown reason
929not ok 695 # TODO [re_tests:695] unknown reason
930not ok 696 # TODO [re_tests:696] unknown reason
931not ok 697 # TODO [re_tests:697] unknown reason
932ok 699 # SKIP [re_tests:699] unknown reason
933ok 700 # SKIP [re_tests:700] unknown reason
934ok 701 # SKIP [re_tests:701] unknown reason
935ok 702 # SKIP [re_tests:702] unknown reason
936ok 703 # SKIP [re_tests:703] unknown reason
937ok 704 # SKIP [re_tests:704] unknown reason
938ok 705 # SKIP [re_tests:705] unknown reason
939ok 706 # SKIP [re_tests:706] unknown reason
940ok 707 # SKIP [re_tests:707] unknown reason
941ok 717 # SKIP [re_tests:717] unknown reason
942ok 718 # SKIP [re_tests:718] unknown reason
943ok 719 # SKIP [re_tests:719] unknown reason
944ok 720 # SKIP [re_tests:720] unknown reason
945ok 721 # SKIP [re_tests:721] unknown reason
946ok 722 # SKIP [re_tests:722] unknown reason
947ok 723 # SKIP [re_tests:723] unknown reason
948ok 724 # SKIP [re_tests:724] unknown reason
949ok 725 # SKIP [re_tests:725] unknown reason
950ok 735 # SKIP [re_tests:735] unknown reason
951ok 736 # SKIP [re_tests:736] unknown reason
952ok 737 # SKIP [re_tests:737] unknown reason
953ok 738 # SKIP [re_tests:738] unknown reason
954ok 739 # SKIP [re_tests:739] unknown reason
955ok 740 # SKIP [re_tests:740] unknown reason
956ok 741 # SKIP [re_tests:741] unknown reason
957ok 742 # SKIP [re_tests:742] unknown reason
958ok 743 # SKIP [re_tests:743] unknown reason
959not ok 747 # TODO [re_tests:747] unknown reason
960not ok 749 # TODO [re_tests:749] unknown reason
961not ok 750 # TODO [re_tests:750] unknown reason
962not ok 751 # TODO [re_tests:751] unknown reason
963ok 753 # SKIP [re_tests:753] unknown reason
964ok 754 # SKIP [re_tests:754] unknown reason
965ok 755 # SKIP [re_tests:755] unknown reason
966ok 756 # SKIP [re_tests:756] unknown reason
967ok 757 # SKIP [re_tests:757] unknown reason
968ok 758 # SKIP [re_tests:758] unknown reason
969ok 759 # SKIP [re_tests:759] unknown reason
970ok 760 # SKIP [re_tests:760] unknown reason
971ok 761 # SKIP [re_tests:761] unknown reason
972ok 771 # SKIP [re_tests:771] unknown reason
973ok 772 # SKIP [re_tests:772] unknown reason
974ok 773 # SKIP [re_tests:773] unknown reason
975ok 774 # SKIP [re_tests:774] unknown reason
976ok 775 # SKIP [re_tests:775] unknown reason
977ok 776 # SKIP [re_tests:776] unknown reason
978ok 777 # SKIP [re_tests:777] unknown reason
979ok 778 # SKIP [re_tests:778] unknown reason
980ok 779 # SKIP [re_tests:779] unknown reason
981ok 789 # SKIP [re_tests:789] unknown reason
982ok 790 # SKIP [re_tests:790] unknown reason
983ok 791 # SKIP [re_tests:791] unknown reason
984ok 792 # SKIP [re_tests:792] unknown reason
985ok 793 # SKIP [re_tests:793] unknown reason
986ok 794 # SKIP [re_tests:794] unknown reason
987ok 795 # SKIP [re_tests:795] unknown reason
988ok 796 # SKIP [re_tests:796] unknown reason
989ok 797 # SKIP [re_tests:797] unknown reason
990ok 800 # SKIP [re_tests:800]
991not ok 801 # TODO [re_tests:801] unknown reason
992ok 802 # SKIP [re_tests:802]
993ok 803 # SKIP [re_tests:803]
994ok 805 # SKIP [re_tests:805]
995ok 806 # SKIP [re_tests:806] hangs a parrot
996ok 807 # SKIP [re_tests:807] hangs a parrot
997ok 808 # SKIP [re_tests:808] hangs a parrot
998ok 809 # SKIP [re_tests:809] hangs a parrot
999ok 810 # SKIP [re_tests:810] hangs a parrot
1000ok 811 # SKIP [re_tests:811] hangs a parrot
1001ok 812 # SKIP [re_tests:812] hangs a parrot
1002ok 813 # SKIP [re_tests:813] hangs a parrot
1003ok 814 # SKIP [re_tests:814] hangs a parrot
1004ok 815 # SKIP [re_tests:815] hangs a parrot
1005ok 816 # SKIP [re_tests:816] hangs a parrot
1006ok 817 # SKIP [re_tests:817] hangs a parrot
1007ok 818 # SKIP [re_tests:818] hangs a parrot
1008ok 819 # SKIP [re_tests:819] hangs a parrot
1009ok 820 # SKIP [re_tests:820] hangs a parrot
1010ok 821 # SKIP [re_tests:821] hangs a parrot
1011ok 822 # SKIP [re_tests:822] hangs a parrot
1012ok 823 # SKIP [re_tests:823] hangs a parrot
1013not ok 827 # TODO [re_tests:827] \d in character class
1014ok 828 # SKIP [re_tests:828]
1015ok 829 # SKIP [re_tests:829]
1016ok 830 # SKIP [re_tests:830]
1017ok 834 # SKIP [re_tests:834]
1018ok 835 # SKIP [re_tests:835]
1019ok 836 # SKIP [re_tests:836]
1020ok 838 # SKIP [re_tests:838]
1021not ok 858 # TODO [re_tests:858] unknown reason
1022ok 859 # SKIP [re_tests:859]
1023ok 862 # SKIP [re_tests:862]
1024not ok 865 # TODO [re_tests:865] unknown reason
1025not ok 866 # TODO [re_tests:866] unknown reason
1026ok 877 # SKIP [re_tests:877]
1027ok 879 # SKIP [re_tests:879] [ID 20010811.006]
1028not ok 881 # TODO [re_tests:881] unknown reason
1029ok 886 # SKIP [re_tests:886]
1030not ok 887 # TODO [re_tests:887] unknown reason
1031not ok 888 # TODO [re_tests:888] unknown reason
1032not ok 890 # TODO [re_tests:890] unknown reason
1033not ok 891 # TODO [re_tests:891] unknown reason
1034not ok 893 # TODO [re_tests:893] unknown reason
1035not ok 896 # TODO [re_tests:896] unknown reason
1036not ok 897 # TODO [re_tests:897] unknown reason
1037not ok 898 # TODO [re_tests:898] unknown reason
1038not ok 899 # TODO [re_tests:899] unknown reason
1039not ok 901 # TODO [re_tests:901] greediness/lookbehind
1040not ok 904 # TODO [re_tests:904] greediness/lookbehind
1041not ok 905 # TODO [re_tests:905] greediness/lookbehind
1042not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion
1043not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion
1044not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion
1045not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion
1046not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion
1047not ok 915 # TODO [re_tests:915] non-greedy/lookbehind
1048not ok 916 # TODO [re_tests:916] non-greedy/lookbehind
1049not ok 918 # TODO [re_tests:918] non-greedy/lookbehind
1050not ok 921 # TODO [re_tests:921] non-greedy/lookbehind
1051not ok 922 # TODO [re_tests:922] non-greedy/lookbehind
1052not ok 923 # TODO [re_tests:923] unmatched bracket
1053ok 924 # SKIP [re_tests:924]
1054ok 926 # SKIP [re_tests:926] [perl #18019]
1055not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171]
1056not ok 928 # TODO [re_tests:928] reuse captured group
1057not ok 929 # TODO [re_tests:929] reuse captured group
1058not ok 930 # TODO [re_tests:930] reuse captured group
1059not ok 931 # TODO [re_tests:931] reuse captured group
1060not ok 932 # TODO [re_tests:932] reuse captured group
1061not ok 933 # TODO [re_tests:933] reuse captured group
1062not ok 934 # TODO [re_tests:934] reuse captured group
1063not ok 935 # TODO [re_tests:935] reuse captured group
1064not ok 936 # TODO [re_tests:936] reuse captured group
1065not ok 937 # TODO [re_tests:937] reuse captured group
1066not ok 938 # TODO [re_tests:938] reuse captured group
1067not ok 939 # TODO [re_tests:939] reuse captured group
1068not ok 940 # TODO [re_tests:940] reuse captured group
1069not ok 941 # TODO [re_tests:941] reuse captured group
1070not ok 942 # TODO [re_tests:942] reuse captured group
1071ok 944 # SKIP [re_tests:944] unknown reason
1072ok 945 # SKIP [re_tests:945] unknown reason
1073ok 957 # SKIP [re_tests:957]
1074ok 958 # SKIP [re_tests:958]
1075not ok 959 # TODO [re_tests:959] [perl #34195]
1076not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion
1077ok
1078t/compilers/pge/perl6regex/01-regex....
1079not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&|) - parse error
1080not ok 99 # TODO [rx_metachars:114] null pattern invalid
1081not ok 386 # TODO [rx_backtrack:4] basic
1082not ok 427 # TODO [rx_charclass:26] illegal character range
1083not ok 458 # TODO [rx_charclass:62] literal match (\")
1084not ok 459 # TODO [rx_charclass:64] literal match (\")
1085not ok 460 # TODO [rx_charclass:66] literal match with quote
1086not ok 461 # TODO [rx_charclass:68] literal match with quote
1087not ok 462 # TODO [rx_charclass:70] literal match with backslash
1088not ok 463 # TODO [rx_charclass:72] literal match with interpolation
1089not ok 464 # TODO [rx_charclass:74] literal match with interpolation
1090not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i)
1091not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s)
1092not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s)
1093not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s)
1094not ok 709 # TODO [rx_modifiers:131] basic ws match
1095not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5)
1096not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth)
1097not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth)
1098ok
1099t/compilers/pge/perl6regex/context.....
1100not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented
1101ok
1102t/compilers/tge/basic..................ok
1103t/compilers/tge/grammar................
1104not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug
1105ok
1106t/compilers/tge/parser.................ok
1107t/library/cgi_query_hash...............ok
1108t/library/coroutine....................ok
1109t/library/dumper.......................ok
1110t/library/getopt_obj...................ok
1111t/library/hllmacros....................ok
1112t/library/iter.........................ok
1113t/library/md5..........................ok
1114t/library/mime_base64..................ok
1115t/library/mt19937ar....................ok
1116t/library/p6object.....................
1117not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) >
1118ok
1119t/library/parrotlib....................ok
1120t/library/pcre.........................
1121ok 1 # SKIP no pcre-config
1122ok
1123t/library/pg...........................
1124ok 1 # SKIP skipped
1125ok 2 # SKIP skipped
1126ok 3 # SKIP skipped
1127ok 4 # SKIP skipped
1128ok 5 # SKIP skipped
1129ok 6 # SKIP skipped
1130ok 7 # SKIP skipped
1131ok 8 # SKIP skipped
1132ok 9 # SKIP skipped
1133ok 10 # SKIP skipped
1134ok 11 # SKIP skipped
1135ok 12 # SKIP skipped
1136ok 13 # SKIP skipped
1137ok 14 # SKIP skipped
1138ok 15 # SKIP skipped
1139ok 16 # SKIP skipped
1140ok 17 # SKIP skipped
1141ok 18 # SKIP skipped
1142ok 19 # SKIP skipped
1143ok 20 # SKIP skipped
1144ok 21 # SKIP skipped
1145ok 22 # SKIP skipped
1146ok 23 # SKIP skipped
1147ok 24 # SKIP skipped
1148ok 25 # SKIP skipped
1149ok 26 # SKIP skipped
1150ok 27 # SKIP skipped
1151ok 28 # SKIP skipped
1152ok 29 # SKIP skipped
1153ok 30 # SKIP skipped
1154ok 31 # SKIP skipped
1155ok 32 # SKIP skipped
1156ok 33 # SKIP skipped
1157ok 34 # SKIP skipped
1158ok 35 # SKIP skipped
1159ok 36 # SKIP skipped
1160ok 37 # SKIP skipped
1161ok 38 # SKIP skipped
1162ok 39 # SKIP skipped
1163ok 40 # SKIP skipped
1164ok 41 # SKIP skipped
1165ok 42 # SKIP skipped
1166ok 43 # SKIP skipped
1167ok
1168t/library/protoobject..................ok
1169t/library/rand.........................ok
1170t/library/range........................ok
1171t/library/streams......................
1172ok 18 # SKIP broken method invocation
1173ok 20 # SKIP broken method invocation
1174ok
1175t/library/string_utils.................ok
1176t/library/tcl_glob.....................ok
1177t/library/tcl_lib......................ok
1178t/library/test_builder_tester..........ok
1179t/library/test_class...................ok
1180t/library/test_more....................ok
1181t/library/uuid.........................ok
1182t/library/yaml_dumper..................
1183not ok 7 - properties # TODO not yet implemented
1184not ok 8 - indent string # TODO not supported
1185not ok 9 - back-referencing properties # TODO not yet implemented
1186not ok 10 - self-referential properties (1) # TODO not yet implemented
1187not ok 11 - self-referential properties (2) # TODO not yet implemented
1188not ok 26 - custom dumper # TODO not yet implemented
1189ok
1190t/library/yaml_parser_syck.............
1191not ok 1 - basic parsing # TODO Not properly implemented yet
1192ok
1193All tests successful.
1194Files=252, Tests=8326, 656 wallclock secs ( 6.41 usr  4.34 sys + 193.79 cusr 125.22 csys = 329.76 CPU)
1195Result: PASS
1196perl t/harness --gc-debug --running-make-test -C --runcore-tests
1197t/compilers/imcc/imcpasm/cfg...........ok
1198t/compilers/imcc/imcpasm/opt0..........
1199ok 1 # SKIP disabled graph coloring register allocator, RT #57028
1200ok 3 # SKIP disabled graph coloring register allocator, RT #57028
1201ok
1202t/compilers/imcc/imcpasm/opt1..........
1203ok 76 # SKIP constant concat N/Y
1204ok
1205t/compilers/imcc/imcpasm/opt2..........
1206ok 5 # SKIP loop opt disabled for now
1207ok
1208t/compilers/imcc/imcpasm/optc..........
1209not ok 9 - tailcall 1 # TODO RT #57028
1210ok
1211t/compilers/imcc/imcpasm/pcc...........ok
1212t/compilers/imcc/imcpasm/sub...........ok
1213t/compilers/imcc/reg/alloc.............ok
1214t/compilers/imcc/reg/spill.............ok
1215t/compilers/imcc/syn/bsr...............ok
1216t/compilers/imcc/syn/clash.............
1217not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet
1218ok
1219t/compilers/imcc/syn/const.............ok
1220t/compilers/imcc/syn/errors............ok
1221t/compilers/imcc/syn/eval..............
1222ok 1 # SKIP changed eval semantics - see t/pmc/eval.t
1223ok 2 # SKIP changed eval semantics - see t/pmc/eval.t
1224ok 3 # SKIP changed eval semantics - see t/pmc/eval.t
1225ok 4 # SKIP changed eval semantics - see t/pmc/eval.t
1226ok 5 # SKIP changed eval semantics - see t/pmc/eval.t
1227ok 6 # SKIP changed eval semantics - see t/pmc/eval.t
1228ok 7 # SKIP changed eval semantics - see t/pmc/eval.t
1229ok
1230t/compilers/imcc/syn/file..............
1231ok 13 # SKIP multiple loading not speced - failing
1232ok
1233t/compilers/imcc/syn/hll...............ok
1234t/compilers/imcc/syn/keyed.............
1235ok 1 # SKIP experimental
1236ok
1237t/compilers/imcc/syn/labels............ok
1238t/compilers/imcc/syn/macro.............
1239not ok 25 - unterminated macro 2 # TODO Darwin segfault -- RT #60926
1240ok
1241t/compilers/imcc/syn/objects...........ok
1242t/compilers/imcc/syn/op................ok
1243t/compilers/imcc/syn/pasm..............ok
1244t/compilers/imcc/syn/pcc...............ok
1245t/compilers/imcc/syn/pod...............
1246ok 4 # SKIP Closing out of pod from included files
1247ok
1248t/compilers/imcc/syn/regressions.......
1249not ok 4 - comments between .param(RT \#46499) # TODO broken
1250not ok 6 - whitespace between .param(RT \#46499) # TODO broken
1251not ok 7 - off by one error message (RT \#40204) # TODO broken
1252ok
1253t/compilers/imcc/syn/scope.............ok
1254t/compilers/imcc/syn/subflags..........
1255not ok 15 # TODO :method sub not found in namespace
1256ok
1257t/compilers/imcc/syn/symbols...........ok
1258t/compilers/imcc/syn/tail..............ok
1259t/compilers/imcc/syn/veracity..........ok
1260t/op/00ff-dos..........................ok
1261t/op/00ff-unix.........................ok
1262t/op/01-parse_ops......................ok
1263t/op/64bit.............................
12641..0 # Skip 64bit INTVAL platforms only
1265skipped: 64bit INTVAL platforms only
1266t/op/annotate..........................ok
1267t/op/arithmetics.......................
1268ok 28 # SKIP No integer overflow for 32-bit INTVALs without GMP installed
1269ok
1270t/op/basic.............................ok
1271t/op/bitwise...........................
1272ok 27 # SKIP no BigInt lib found
1273ok
1274t/op/box...............................ok
1275t/op/calling...........................
1276not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all
1277not ok 93 - arg mismatch with no params # TODO RT #39844
1278ok
1279t/op/cc_params.........................ok
1280t/op/cc_state..........................
1281not ok 6 - positional found, named expected # TODO cc processor state missing
1282not ok 8 - G2: argument underflow: required slurpy param # TODO failing
1283ok
1284t/op/cmp-nonbranch.....................ok
1285t/op/comp..............................ok
1286t/op/copy..............................ok
1287t/op/debuginfo.........................ok
1288t/op/exceptions........................
1289not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans
1290ok
1291t/op/gc................................ok
1292t/op/globals...........................ok
1293t/op/hacks.............................
1294ok 1 # SKIP no universal SIGFPE handling
1295ok 2 # SKIP no universal SIGFPE handling
1296ok
1297t/op/ifunless..........................ok
1298t/op/integer...........................ok
1299t/op/interp............................
1300ok 1 # SKIP we really shouldn't run just a label - use a sub
1301ok
1302t/op/io................................ok
1303t/op/jit...............................ok
1304t/op/jitn..............................ok
1305t/op/lexicals..........................
1306not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented
1307ok
1308t/op/literal...........................ok
1309t/op/load_bytecode.....................ok
1310t/op/number............................ok
1311t/op/pushaction........................
1312not ok 7 - pushaction: error while handling error # TODO runloop shenanigans
1313ok
1314t/op/say...............................ok
1315t/op/spawnw............................ok
1316t/op/sprintf...........................
1317ok 5 # SKIP parrot extension (%B)
1318ok 7 # SKIP perl5-specific extension (%D)
1319ok 9 # SKIP perl5-specific extension (%F)
1320ok 16 # SKIP parrot extension (%H)
1321ok 20 # SKIP parrot extension (%L)
1322ok 23 # SKIP perl5-specific extension (%O)
1323ok 24 # SKIP parrot extension (%P)
1324ok 27 # SKIP parrot extension (%S)
1325ok 29 # SKIP perl5-specific extension (%U)
1326not ok 64 # TODO [%03.2d]  actual: > 01<
1327ok 71 # SKIP perl5-specific extension (%v...)
1328ok 72 # SKIP perl5-specific extension (%v...)
1329ok 73 # SKIP perl5-specific extension (%v...)
1330ok 74 # SKIP perl5-specific extension (%v...)
1331ok 75 # SKIP perl5-specific extension (%v...)
1332ok 76 # SKIP perl5-specific extension (%v...)
1333ok 77 # SKIP perl5-specific extension (%v...)
1334ok 78 # SKIP perl5-specific extension (%v...)
1335ok 79 # SKIP perl5-specific extension (%v...)
1336ok 80 # SKIP perl5-specific extension (%v...)
1337ok 81 # SKIP perl5-specific extension (%v...)
1338ok 82 # SKIP perl5-specific extension (%v...)
1339ok 83 # SKIP perl5-specific extension (%v...)
1340ok 84 # SKIP perl5-specific extension (%v...)
1341ok 85 # SKIP perl5-specific extension (%v...)
1342ok 86 # SKIP perl5-specific extension (%v...)
1343ok 87 # SKIP perl5-specific extension (%v...)
1344ok 88 # SKIP perl5-specific extension (%v...)
1345ok 89 # SKIP perl5-specific extension (%v...)
1346ok 90 # SKIP perl5-specific extension (%v...)
1347ok 91 # SKIP perl5-specific extension (%v...)
1348ok 92 # SKIP perl5-specific extension (%v...)
1349ok 93 # SKIP perl5-specific extension (%v...)
1350ok 94 # SKIP perl5-specific extension (%v...)
1351ok 95 # SKIP perl5-specific extension (%v...)
1352ok 96 # SKIP perl5-specific extension (%v...)
1353ok 97 # SKIP perl5-specific extension (%v...)
1354ok 98 # SKIP perl5-specific extension (%v...)
1355ok 99 # SKIP perl5-specific extension (%v...)
1356ok 114 # SKIP harness needs support for * modifier
1357ok 131 # SKIP harness needs support for * modifier
1358ok 141 # SKIP harness needs support for * modifier
1359ok 144 # SKIP perl5 expresssion as test value
1360not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1<
1361ok 161 # SKIP harness needs support for * modifier
1362ok 166 # SKIP harness needs support for * modifier
1363not ok 187 # TODO [%h]  actual: ><
1364not ok 191 # TODO [%l]  actual: ><
1365ok 193 # SKIP perl5-specific test
1366ok 200 # SKIP perl5-specific test
1367ok 201 # SKIP perl5-specific test
1368ok 202 # SKIP parrot extension (%p)
1369ok 204 # SKIP parrot extension (%r)
1370ok 210 # SKIP harness needs support for * modifier
1371ok 214 # SKIP harness needs support for * modifier
1372not ok 223 # TODO [%v]  actual: ><
1373ok 233 # SKIP harness needs support for * modifier
1374ok 234 # SKIP perl5-specific extension (%v...)
1375ok 235 # SKIP perl5-specific extension (%v...)
1376ok 238 # SKIP perl5-specific test
1377ok 239 # SKIP perl5-specific test
1378ok 240 # SKIP perl5-specific test
1379ok 241 # SKIP perl5-specific test
1380ok 242 # SKIP perl5-specific test
1381ok 243 # SKIP perl5-specific test
1382ok 244 # SKIP perl5-specific test
1383ok 245 # SKIP perl5-specific test
1384ok 246 # SKIP perl5-specific test
1385ok 247 # SKIP perl5-specific test
1386ok 248 # SKIP perl5-specific test
1387ok 249 # SKIP perl5-specific test
1388ok 250 # SKIP perl5-specific test
1389ok 251 # SKIP perl5-specific test
1390ok 252 # SKIP perl5-specific extension (%v...)
1391ok 253 # SKIP perl5-specific extension (%v...)
1392ok 254 # SKIP perl5-specific extension (%v...)
1393ok 255 # SKIP perl5-specific extension (%v...)
1394ok 256 # SKIP perl5-specific extension (%v...)
1395ok 257 # SKIP perl5-specific extension (%v...)
1396ok 258 # SKIP perl5-specific extension (%v...)
1397ok 259 # SKIP perl5-specific extension (%v...)
1398ok 260 # SKIP perl5-specific extension (%v...)
1399ok 261 # SKIP perl5-specific extension (%v...)
1400ok 262 # SKIP perl5-specific extension (%v...)
1401ok 263 # SKIP perl5-specific extension (%v...)
1402ok 264 # SKIP perl5-specific extension (%v...)
1403ok 265 # SKIP perl5-specific extension (%v...)
1404ok 266 # SKIP perl5-specific extension (%v...)
1405ok 267 # SKIP perl5-specific extension (%v...)
1406ok 268 # SKIP perl5-specific extension (%v...)
1407ok 269 # SKIP perl5-specific extension (%v...)
1408ok 270 # SKIP perl5-specific extension (%v...)
1409ok 271 # SKIP perl5-specific extension (%v...)
1410ok 272 # SKIP perl5-specific extension (%v...)
1411ok 273 # SKIP perl5-specific extension (%v...)
1412ok 274 # SKIP perl5-specific extension (%v...)
1413ok 275 # SKIP perl5-specific extension (%v...)
1414ok 276 # SKIP perl5-specific extension (%v...)
1415ok 277 # SKIP perl5-specific extension (%v...)
1416ok 278 # SKIP perl5-specific extension (%v...)
1417ok 279 # SKIP perl5-specific extension (%v...)
1418ok 280 # SKIP perl5-specific extension (%v...)
1419ok 281 # SKIP perl5-specific extension (%v...)
1420ok 282 # SKIP perl5-specific extension (%v...)
1421ok 283 # SKIP perl5-specific extension (%v...)
1422ok 284 # SKIP perl5-specific extension (%v...)
1423ok 285 # SKIP perl5-specific extension (%v...)
1424ok 286 # SKIP perl5-specific extension (%v...)
1425ok 287 # SKIP perl5-specific extension (%v...)
1426ok 288 # SKIP perl5-specific extension (%v...)
1427ok 289 # SKIP perl5-specific extension (%v...)
1428ok 290 # SKIP perl5-specific extension (%v...)
1429ok 291 # SKIP perl5-specific extension (%v...)
1430ok 292 # SKIP perl5-specific extension (%v...)
1431ok 293 # SKIP perl5-specific extension (%v...)
1432ok 294 # SKIP perl5-specific extension (%v...)
1433ok 295 # SKIP perl5-specific extension (%v...)
1434ok 296 # SKIP perl5-specific extension (%v...)
1435ok 297 # SKIP perl5-specific extension (%v...)
1436ok 298 # SKIP perl5-specific extension (%v...)
1437ok 300 # SKIP harness needs support for * modifier
1438not ok 304 # TODO [%#b]  actual: >0b0<
1439not ok 305 # TODO [%#o]  actual: >00<
1440not ok 306 # TODO [%#x]  actual: >0x0<
1441ok 307 # SKIP perl5-specific extension (%v...)
1442ok 308 # SKIP perl5-specific extension (%v...)
1443ok
1444t/op/sprintf2..........................ok
1445t/op/string............................
1446ok 103 # SKIP Pending rework of creating non-ascii literals
1447ok 104 # SKIP Pending rework of creating non-ascii literals
1448ok 118 # SKIP Pending reimplementation of find_encoding
1449ok 119 # SKIP no more visible encoding
1450ok 137 # SKIP No unicode yet
1451ok 139 # SKIP no more transcode
1452ok 140 # SKIP no more chartype
1453ok
1454t/op/string_cclass.....................
1455ok 7 # SKIP unicode support unavailable
1456ok 8 # SKIP unicode support unavailable
1457ok 9 # SKIP unicode support unavailable
1458ok
1459t/op/string_cs.........................
1460ok 31 # SKIP no ICU lib
1461ok 32 # SKIP no ICU lib
1462ok 33 # SKIP no ICU lib
1463ok 34 # SKIP no ICU lib
1464ok 35 # SKIP no ICU lib
1465ok 36 # SKIP no ICU lib
1466ok 37 # SKIP no ICU lib
1467ok 38 # SKIP no ICU lib
1468ok 39 # SKIP no ICU lib
1469ok 40 # SKIP no ICU lib
1470ok 41 # SKIP no ICU lib
1471ok 42 # SKIP no ICU lib
1472ok 43 # SKIP no ICU lib
1473ok 44 # SKIP no ICU lib
1474ok 45 # SKIP no ICU lib
1475ok 46 # SKIP no ICU lib
1476ok
1477t/op/string_mem........................ok
1478t/op/stringu...........................
1479ok 20 # SKIP no ICU lib
1480ok 21 # SKIP no ICU lib
1481ok 22 # SKIP no ICU lib
1482ok 25 # SKIP Tests seem to fail on big endian machines with icu
1483ok 26 # SKIP Tests seem to fail on big endian machines with icu
1484not ok 27 - UTF-8 and Unicode literals # TODO TT #24
1485ok
1486t/op/sysinfo...........................
1487not ok 11 - sysinfo OS version string # TODO Not Currently Implemented
1488not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented
1489ok 13 # SKIP Requires a lot of work to find out the correct answer
1490ok 14 # SKIP Testing only in some known platforms
1491ok
1492t/op/time..............................ok
1493t/op/trans.............................ok
1494t/pmc/addrregistry.....................ok
1495t/pmc/array............................
1496not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken
1497ok
1498t/pmc/bigint...........................
14991..0 # Skip No BigInt Lib configured
1500skipped: No BigInt Lib configured
1501t/pmc/bignum...........................
15021..0 # Skip No BigNum PMC enabled
1503skipped: No BigNum PMC enabled
1504t/pmc/boolean..........................ok
1505t/pmc/bound_nci........................ok
1506t/pmc/callsignature....................ok
1507t/pmc/capture..........................ok
1508t/pmc/class............................
1509not ok 28 # TODO add_method() invoking method added to class works
1510ok
1511t/pmc/codestring.......................ok
1512t/pmc/complex..........................
1513ok 58 # SKIP div by zero not caught
1514ok 59 # SKIP div by zero not caught
1515ok 60 # SKIP div by zero not caught
1516ok 86 # SKIP instantiate n/y
1517ok 87 # SKIP instantiate n/y
1518ok 88 # SKIP instantiate n/y
1519ok 89 # SKIP instantiate n/y
1520ok 126 # SKIP inf is not platform-independent
1521ok 465 # SKIP add using subclass of Complex - RT #59630
1522ok 466 # SKIP add using subclass of Complex - RT #59630
1523ok 467 # SKIP add using subclass of Complex - RT #59630
1524ok
1525t/pmc/config...........................ok
1526t/pmc/continuation.....................ok
1527t/pmc/coroutine........................
1528not ok 9 - Call an exited coroutine # TODO goes one iteration too far.
1529ok
1530t/pmc/cpointer.........................ok
1531t/pmc/default..........................
1532not ok 1 - new # TODO not implemeted
1533ok
1534t/pmc/env..............................ok
1535t/pmc/eval.............................ok
1536t/pmc/eventhandler.....................ok
1537t/pmc/exception........................
1538not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans
1539not ok 25 - pushaction: error while handling error # TODO runloop shenanigans
1540not ok 27 - invoke handler in calling sub # TODO deprecate rethrow
1541ok 30 - catch ex from C-level MULTI function # TODO broken
1542ok
1543t/pmc/exceptionhandler.................ok
1544t/pmc/exporter.........................ok
1545t/pmc/file.............................ok
1546t/pmc/filehandle.......................
1547ok 3 # SKIP no asynch calls yet
1548not ok 8 - record_separator # TODO not yet implemented
1549ok
1550t/pmc/fixedbooleanarray................ok
1551t/pmc/fixedfloatarray..................ok
1552t/pmc/fixedintegerarray................ok
1553t/pmc/fixedpmcarray....................ok
1554t/pmc/fixedstringarray.................ok
1555t/pmc/float............................ok
1556t/pmc/freeze...........................ok
1557t/pmc/globals..........................ok
1558t/pmc/hash.............................ok
1559t/pmc/integer..........................ok
1560t/pmc/io...............................
1561not ok 1 - IO on some invalid types # TODO IO on some invalid types
1562ok 8 # SKIP clone not finished yet
1563not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433
1564not ok 40 - string read/write handle # TODO no stringhandle yet
1565ok
1566t/pmc/io_iterator......................
1567not ok 1 - new # TODO not yet implemented
1568not ok 2 - shift # TODO not yet implemented
1569not ok 3 - get_bool (vtable) # TODO not yet implemented
1570ok
1571t/pmc/io_status........................
1572not ok 1 - new # TODO not yet implemented
1573not ok 2 - get_integer (vtable) # TODO not yet implemented
1574not ok 3 - get_bool (vtable) # TODO not yet implemented
1575not ok 4 - return # TODO not yet implemented
1576not ok 5 - error # TODO not yet implemented
1577not ok 6 - throw # TODO not yet implemented
1578ok
1579t/pmc/iterator.........................
1580ok 13 # SKIP N/Y: length of rest of array
1581not ok 16 - adding keys during iteration # TODO adding keys during iteration
1582not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points'
1583ok
1584t/pmc/key..............................
1585not ok 10 # TODO register and non-register string keys should be COW (RT #60128)
1586ok
1587t/pmc/lexinfo..........................ok
1588t/pmc/lexpad...........................ok
1589t/pmc/managedstruct....................ok
1590t/pmc/multidispatch....................
1591not ok 22 - MMD on PMC types - Any # TODO RT #41374
1592not ok 25 - add as method - inherited # TODO RT #41374
1593not ok 32 - use a core func for an object # TODO RT #59628
1594ok
1595t/pmc/multisub.........................ok
1596t/pmc/namespace........................
1597not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17
1598ok
1599t/pmc/nci..............................ok
1600t/pmc/null.............................ok
1601t/pmc/object-meths.....................
1602ok 14 # SKIP currently broken
1603ok 25 # SKIP no bound NCI method
1604ok
1605t/pmc/object-mro.......................ok
1606t/pmc/object...........................ok
1607t/pmc/objects..........................ok
1608t/pmc/orderedhash......................ok
1609t/pmc/os...............................ok
1610t/pmc/packfile.........................ok
1611t/pmc/packfileconstanttable............
1612not ok 3 - get_type, get_*_keyed_int # TODO See TT #385.
1613ok
1614t/pmc/packfiledirectory................ok
1615t/pmc/packfilefixupentry...............ok
1616t/pmc/packfilefixuptable...............ok
1617t/pmc/packfilerawsegment...............ok
1618t/pmc/packfilesegment..................ok
1619t/pmc/parrotclass......................ok
1620t/pmc/parrotinterpreter................ok
1621t/pmc/parrotio.........................
1622not ok 2 - open and close - synchronous # TODO not yet implemented
1623ok 3 # SKIP no asynch calls yet
1624not ok 4 - print, read, and readline - synchronous # TODO not yet implemented
1625not ok 5 - record_separator # TODO not yet implemented
1626not ok 6 - buffer_type # TODO not yet implemented
1627ok
1628t/pmc/parrotlibrary....................ok
1629t/pmc/parrotobject.....................ok
1630t/pmc/parrotrunningthread..............ok
1631t/pmc/parrotthread.....................ok
1632t/pmc/pccmethod_test...................ok
1633t/pmc/pmc..............................ok
1634t/pmc/pmcproxy.........................ok
1635t/pmc/pointer..........................ok
1636t/pmc/prop.............................ok
1637t/pmc/random...........................ok
1638t/pmc/ref..............................ok
1639t/pmc/resizablebooleanarray............ok
1640t/pmc/resizablefloatarray..............ok
1641t/pmc/resizableintegerarray............ok
1642t/pmc/resizablepmcarray................ok
1643t/pmc/resizablestringarray.............ok
1644t/pmc/retcontinuation..................ok
1645t/pmc/ro...............................
1646not ok 8 - ResizablePMCArray -- Recursive # TODO 1
1647ok
1648t/pmc/role.............................ok
1649t/pmc/scalar...........................
1650ok 1 # SKIP doesn't work yet
1651ok
1652t/pmc/scheduler........................ok
1653t/pmc/schedulermessage.................ok
1654t/pmc/sharedref........................ok
1655t/pmc/signal...........................
16561..0 # Skip Signals currently disabled
1657skipped: Signals currently disabled
1658t/pmc/slice............................
1659not ok 2 - bug with slice bits # TODO parser
1660ok
1661t/pmc/string...........................ok
1662t/pmc/stringhandle.....................
1663ok 3 # SKIP no asynch calls yet
1664not ok 9 - record_separator # TODO not yet implemented
1665ok
1666t/pmc/sub..............................ok
1667t/pmc/sys..............................ok
1668t/pmc/task.............................ok
1669t/pmc/threads..........................
1670not ok 11 - CLONE_CODE | CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511
1671not ok 14 - globals + constant table subs issue # TODO Broken with CGP
1672not ok 15 - CLONE_CODE|CLONE_GLOBALS|CLONE_HLL|CLONE_LIBRARIES # TODO RT #41373
1673ok
1674t/pmc/timer............................ok
1675t/pmc/undef............................ok
1676t/pmc/unmanagedstruct..................ok
1677t/oo/attributes........................ok
1678t/oo/composition.......................ok
1679t/oo/inheritance.......................ok
1680t/oo/isa...............................ok
1681t/oo/metamodel.........................
1682not ok 6 # TODO tail attribute has a type
1683not ok 12 # TODO new opcode makes working objects
1684ok
1685t/oo/methods...........................ok
1686t/oo/mro-c3............................ok
1687t/oo/names.............................ok
1688t/oo/new...............................ok
1689t/oo/ops...............................ok
1690t/oo/proxy.............................ok
1691t/oo/subclass..........................ok
1692t/oo/vtableoverride....................ok
1693t/native_pbc/header....................
16941..0 # Skip pending robust testing strategy, TT #357
1695skipped: pending robust testing strategy, TT #357
1696t/native_pbc/integer...................
16971..0 # Skip pending robust testing strategy, TT #357
1698skipped: pending robust testing strategy, TT #357
1699t/native_pbc/number....................
17001..0 # Skip pending robust testing strategy, TT #357
1701skipped: pending robust testing strategy, TT #357
1702t/native_pbc/string....................
17031..0 # Skip pending robust testing strategy, TT #357
1704skipped: pending robust testing strategy, TT #357
1705t/dynpmc/dynlexpad.....................
1706not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads
1707ok
1708t/dynpmc/foo...........................
1709ok 6 # SKIP No BigInt Lib configured
1710ok
1711t/dynpmc/gdbmhash......................
17121..0 # Skip No gdbm library available
1713skipped: No gdbm library available
1714t/dynpmc/md2...........................ok
1715t/dynpmc/md4...........................ok
1716t/dynpmc/md5...........................ok
1717t/dynpmc/pair..........................ok
1718t/dynpmc/rational......................ok
1719t/dynpmc/ripemd160.....................ok
1720t/dynpmc/rotest........................ok
1721t/dynpmc/sha...........................ok
1722t/dynpmc/sha1..........................ok
1723t/dynpmc/sha256........................
17241..0 # Skip Too old library
1725skipped: Too old library
1726t/dynpmc/sha512........................
17271..0 # Skip Too old library
1728skipped: Too old library
1729t/dynpmc/subclass_with_pir_method......
1730not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces
1731not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces
1732ok
1733t/dynpmc/subproxy......................ok
1734t/dynoplibs/dan........................ok
1735t/dynoplibs/myops......................ok
1736t/compilers/pct/complete_workflow......ok
1737t/compilers/pct/past...................ok
1738t/compilers/pct/pct_hllcompiler........ok
1739t/compilers/pct/post...................ok
1740t/compilers/pge/00-basic...............ok
1741t/compilers/pge/02-match...............ok
1742t/compilers/pge/03-optable.............ok
1743t/compilers/pge/04-compile.............ok
1744t/compilers/pge/06-grammar.............ok
1745t/compilers/pge/pge-hs.................ok
1746t/compilers/pge/pge....................ok
1747t/compilers/pge/pge_examples...........ok
1748t/compilers/pge/pge_globs..............ok
1749t/compilers/pge/pge_text...............ok
1750t/compilers/pge/pge_util...............ok
1751t/compilers/pge/p5regex/p5rx...........
1752not ok 116 # TODO [re_tests:116] character class in enumeration
1753not ok 119 # TODO [re_tests:119] character class in enumeration
1754not ok 120 # TODO [re_tests:120] character class in enumeration
1755not ok 123 # TODO [re_tests:123] character class in enumeration
1756not ok 124 # TODO [re_tests:124] character class in enumeration
1757not ok 127 # TODO [re_tests:127] character class in enumeration
1758ok 138 # SKIP [re_tests:138] parser bug
1759ok 139 # SKIP [re_tests:139] broken col 4?
1760ok 143 # SKIP [re_tests:143] bug or error
1761ok 144 # SKIP [re_tests:144] bug or error
1762ok 148 # SKIP [re_tests:148] bug or error
1763ok 149 # SKIP [re_tests:149] bug or error
1764ok 155 # SKIP [re_tests:155] bug or error
1765ok 167 # SKIP [re_tests:167] bug or error
1766not ok 234 # TODO [re_tests:234] unknown reason
1767not ok 235 # TODO [re_tests:235] unknown reason
1768not ok 236 # TODO [re_tests:236] unknown reason
1769not ok 246 # TODO [re_tests:246] unknown reason
1770not ok 247 # TODO [re_tests:247] unknown reason
1771ok 248 # SKIP [re_tests:248] bug or error
1772ok 249 # SKIP [re_tests:249] bug or error
1773ok 252 # SKIP [re_tests:252] bug or error
1774not ok 254 # TODO [re_tests:254] unknown reason
1775not ok 256 # TODO [re_tests:256] unknown reason
1776not ok 257 # TODO [re_tests:257] unknown reason
1777ok 264 # SKIP [re_tests:264] trailing modifiers
1778ok 265 # SKIP [re_tests:265] trailing modifiers
1779ok 266 # SKIP [re_tests:266] trailing modifiers
1780ok 267 # SKIP [re_tests:267] trailing modifiers
1781ok 268 # SKIP [re_tests:268] trailing modifiers
1782ok 269 # SKIP [re_tests:269] trailing modifiers
1783ok 270 # SKIP [re_tests:270] trailing modifiers
1784ok 271 # SKIP [re_tests:271] trailing modifiers
1785ok 272 # SKIP [re_tests:272] trailing modifiers
1786ok 273 # SKIP [re_tests:273] trailing modifiers
1787ok 274 # SKIP [re_tests:274] trailing modifiers
1788ok 275 # SKIP [re_tests:275] trailing modifiers
1789ok 276 # SKIP [re_tests:276] trailing modifiers
1790ok 277 # SKIP [re_tests:277] trailing modifiers
1791ok 278 # SKIP [re_tests:278] trailing modifiers
1792ok 279 # SKIP [re_tests:279] trailing modifiers
1793ok 280 # SKIP [re_tests:280] trailing modifiers
1794ok 281 # SKIP [re_tests:281] trailing modifiers
1795ok 282 # SKIP [re_tests:282] trailing modifiers
1796ok 283 # SKIP [re_tests:283] trailing modifiers
1797ok 284 # SKIP [re_tests:284] trailing modifiers
1798ok 285 # SKIP [re_tests:285] trailing modifiers
1799ok 286 # SKIP [re_tests:286] trailing modifiers
1800ok 287 # SKIP [re_tests:287] trailing modifiers
1801ok 288 # SKIP [re_tests:288] trailing modifiers
1802ok 289 # SKIP [re_tests:289] trailing modifiers
1803ok 290 # SKIP [re_tests:290] trailing modifiers
1804ok 291 # SKIP [re_tests:291] trailing modifiers
1805ok 292 # SKIP [re_tests:292] trailing modifiers
1806ok 293 # SKIP [re_tests:293] trailing modifiers
1807ok 294 # SKIP [re_tests:294] trailing modifiers
1808ok 295 # SKIP [re_tests:295] trailing modifiers
1809ok 296 # SKIP [re_tests:296] trailing modifiers
1810ok 297 # SKIP [re_tests:297] trailing modifiers
1811ok 298 # SKIP [re_tests:298] trailing modifiers
1812ok 299 # SKIP [re_tests:299] trailing modifiers
1813ok 300 # SKIP [re_tests:300] trailing modifiers
1814ok 301 # SKIP [re_tests:301] trailing modifiers
1815ok 302 # SKIP [re_tests:302] trailing modifiers
1816ok 303 # SKIP [re_tests:303] trailing modifiers
1817ok 304 # SKIP [re_tests:304] trailing modifiers
1818ok 305 # SKIP [re_tests:305] trailing modifiers
1819ok 306 # SKIP [re_tests:306] trailing modifiers
1820ok 307 # SKIP [re_tests:307] trailing modifiers
1821ok 308 # SKIP [re_tests:308] bug or error
1822ok 309 # SKIP [re_tests:309] bug or error
1823ok 310 # SKIP [re_tests:310] bug or error
1824ok 311 # SKIP [re_tests:311] trailing modifiers
1825ok 312 # SKIP [re_tests:312] trailing modifiers
1826ok 313 # SKIP [re_tests:313] trailing modifiers
1827ok 314 # SKIP [re_tests:314] trailing modifiers
1828ok 315 # SKIP [re_tests:315] trailing modifiers
1829ok 316 # SKIP [re_tests:316] trailing modifiers
1830ok 317 # SKIP [re_tests:317] trailing modifiers
1831ok 318 # SKIP [re_tests:318] trailing modifiers
1832ok 319 # SKIP [re_tests:319] trailing modifiers
1833ok 320 # SKIP [re_tests:320] trailing modifiers
1834ok 321 # SKIP [re_tests:321] trailing modifiers
1835ok 322 # SKIP [re_tests:322] bug or error
1836ok 323 # SKIP [re_tests:323] bug or error
1837ok 324 # SKIP [re_tests:324] trailing modifiers
1838ok 325 # SKIP [re_tests:325] bug or error
1839ok 326 # SKIP [re_tests:326] trailing modifiers
1840ok 327 # SKIP [re_tests:327] trailing modifiers
1841ok 328 # SKIP [re_tests:328] trailing modifiers
1842ok 329 # SKIP [re_tests:329] trailing modifiers
1843ok 330 # SKIP [re_tests:330] bug or error
1844ok 331 # SKIP [re_tests:331] bug or error
1845ok 332 # SKIP [re_tests:332] trailing modifiers
1846ok 333 # SKIP [re_tests:333] trailing modifiers
1847ok 334 # SKIP [re_tests:334] trailing modifiers
1848ok 335 # SKIP [re_tests:335] trailing modifiers
1849ok 336 # SKIP [re_tests:336] bug or error
1850ok 337 # SKIP [re_tests:337] trailing modifiers
1851ok 338 # SKIP [re_tests:338] trailing modifiers
1852ok 339 # SKIP [re_tests:339] trailing modifiers
1853ok 340 # SKIP [re_tests:340] trailing modifiers
1854ok 341 # SKIP [re_tests:341] trailing modifiers
1855ok 342 # SKIP [re_tests:342] trailing modifiers
1856ok 343 # SKIP [re_tests:343] trailing modifiers
1857ok 344 # SKIP [re_tests:344] trailing modifiers
1858ok 345 # SKIP [re_tests:345] trailing modifiers
1859ok 346 # SKIP [re_tests:346] trailing modifiers
1860ok 347 # SKIP [re_tests:347] bug or error
1861ok 348 # SKIP [re_tests:348] trailing modifiers
1862ok 349 # SKIP [re_tests:349] trailing modifiers
1863ok 350 # SKIP [re_tests:350] trailing modifiers
1864ok 351 # SKIP [re_tests:351] trailing modifiers
1865ok 352 # SKIP [re_tests:352] trailing modifiers
1866ok 353 # SKIP [re_tests:353] trailing modifiers
1867ok 354 # SKIP [re_tests:354] trailing modifiers
1868ok 355 # SKIP [re_tests:355] trailing modifiers
1869ok 356 # SKIP [re_tests:356] trailing modifiers
1870ok 357 # SKIP [re_tests:357] trailing modifiers
1871ok 358 # SKIP [re_tests:358] trailing modifiers
1872ok 359 # SKIP [re_tests:359] trailing modifiers
1873ok 360 # SKIP [re_tests:360] trailing modifiers
1874ok 361 # SKIP [re_tests:361] trailing modifiers
1875ok 362 # SKIP [re_tests:362] trailing modifiers
1876ok 363 # SKIP [re_tests:363] trailing modifiers
1877ok 364 # SKIP [re_tests:364] trailing modifiers
1878ok 365 # SKIP [re_tests:365] trailing modifiers
1879ok 366 # SKIP [re_tests:366] trailing modifiers
1880ok 367 # SKIP [re_tests:367] trailing modifiers
1881ok 368 # SKIP [re_tests:368] trailing modifiers
1882ok 369 # SKIP [re_tests:369] trailing modifiers
1883ok 370 # SKIP [re_tests:370] trailing modifiers
1884ok 371 # SKIP [re_tests:371] trailing modifiers
1885ok 372 # SKIP [re_tests:372] trailing modifiers
1886ok 373 # SKIP [re_tests:373] trailing modifiers
1887ok 374 # SKIP [re_tests:374] trailing modifiers
1888ok 375 # SKIP [re_tests:375] trailing modifiers
1889ok 376 # SKIP [re_tests:376] trailing modifiers
1890ok 377 # SKIP [re_tests:377] trailing modifiers
1891ok 378 # SKIP [re_tests:378] trailing modifiers
1892ok 379 # SKIP [re_tests:379] trailing modifiers
1893ok 380 # SKIP [re_tests:380] trailing modifiers
1894ok 381 # SKIP [re_tests:381] trailing modifiers
1895ok 382 # SKIP [re_tests:382] trailing modifiers
1896ok 383 # SKIP [re_tests:383] trailing modifiers
1897ok 384 # SKIP [re_tests:384] trailing modifiers
1898ok 385 # SKIP [re_tests:385] trailing modifiers
1899ok 386 # SKIP [re_tests:386] trailing modifiers
1900ok 387 # SKIP [re_tests:387] trailing modifiers
1901ok 388 # SKIP [re_tests:388] trailing modifiers
1902ok 389 # SKIP [re_tests:389] trailing modifiers
1903ok 390 # SKIP [re_tests:390] trailing modifiers
1904ok 391 # SKIP [re_tests:391] trailing modifiers
1905ok 392 # SKIP [re_tests:392] trailing modifiers
1906ok 393 # SKIP [re_tests:393] trailing modifiers
1907ok 394 # SKIP [re_tests:394] trailing modifiers
1908ok 395 # SKIP [re_tests:395] trailing modifiers
1909not ok 396 # TODO [re_tests:396] unknown reason
1910not ok 397 # TODO [re_tests:397] unknown reason
1911not ok 398 # TODO [re_tests:398] unknown reason
1912ok 408 # SKIP [re_tests:408] bug or error
1913not ok 419 # TODO [re_tests:419] unknown reason
1914not ok 422 # TODO [re_tests:422] unknown reason
1915not ok 429 # TODO [re_tests:429] unknown reason
1916not ok 432 # TODO [re_tests:432] unknown reason
1917not ok 434 # TODO [re_tests:434] unknown reason
1918not ok 435 # TODO [re_tests:435] unknown reason
1919ok 436 # SKIP [re_tests:436] bug or error
1920not ok 439 # TODO [re_tests:439] unknown reason
1921not ok 446 # TODO [re_tests:446] unknown reason
1922not ok 447 # TODO [re_tests:447] unknown reason
1923not ok 448 # TODO [re_tests:448] unknown reason
1924not ok 449 # TODO [re_tests:449] unknown reason
1925not ok 452 # TODO [re_tests:452] unknown reason
1926not ok 453 # TODO [re_tests:453] unknown reason
1927not ok 454 # TODO [re_tests:454] unknown reason
1928not ok 455 # TODO [re_tests:455] unknown reason
1929ok 458 # SKIP [re_tests:458] unknown reason
1930ok 459 # SKIP [re_tests:459] unknown reason
1931ok 460 # SKIP [re_tests:460] unknown reason
1932ok 461 # SKIP [re_tests:461] unknown reason
1933ok 462 # SKIP [re_tests:462] unknown reason
1934ok 463 # SKIP [re_tests:463] unknown reason
1935ok 464 # SKIP [re_tests:464] unknown reason
1936ok 465 # SKIP [re_tests:465] unknown reason
1937ok 466 # SKIP [re_tests:466] unknown reason
1938ok 467 # SKIP [re_tests:467] unknown reason
1939ok 468 # SKIP [re_tests:468] unknown reason
1940ok 469 # SKIP [re_tests:469] unknown reason
1941ok 470 # SKIP [re_tests:470] unknown reason
1942ok 471 # SKIP [re_tests:471] unknown reason
1943ok 472 # SKIP [re_tests:472] unknown reason
1944ok 473 # SKIP [re_tests:473] unknown reason
1945ok 474 # SKIP [re_tests:474] unknown reason
1946ok 475 # SKIP [re_tests:475] unknown reason
1947ok 476 # SKIP [re_tests:476] unknown reason
1948ok 477 # SKIP [re_tests:477] unknown reason
1949ok 478 # SKIP [re_tests:478] unknown reason
1950ok 479 # SKIP [re_tests:479] unknown reason
1951ok 480 # SKIP [re_tests:480] unknown reason
1952ok 483 # SKIP [re_tests:483]
1953ok 484 # SKIP [re_tests:484]
1954ok 487 # SKIP [re_tests:487] bug or error
1955ok 488 # SKIP [re_tests:488] bug or error
1956ok 489 # SKIP [re_tests:489] bug or error
1957ok 490 # SKIP [re_tests:490] bug or error
1958ok 491 # SKIP [re_tests:491] kills a parrot
1959ok 492 # SKIP [re_tests:492] bug or error
1960ok 493 # SKIP [re_tests:493] kills a parrot
1961not ok 495 # TODO [re_tests:495] unknown reason
1962ok 496 # SKIP [re_tests:496]
1963not ok 498 # TODO [re_tests:498] unknown reason
1964not ok 500 # TODO [re_tests:500] unknown reason
1965not ok 501 # TODO [re_tests:501] unknown reason
1966ok 502 # SKIP [re_tests:502] unknown reason
1967not ok 503 # TODO [re_tests:503] unknown reason
1968not ok 504 # TODO [re_tests:504] unknown reason
1969not ok 505 # TODO [re_tests:505] unknown reason
1970not ok 506 # TODO [re_tests:506] unknown reason
1971not ok 507 # TODO [re_tests:507] unknown reason
1972not ok 508 # TODO [re_tests:508] unknown reason
1973not ok 509 # TODO [re_tests:509] unknown reason
1974not ok 510 # TODO [re_tests:510] unknown reason
1975not ok 511 # TODO [re_tests:511] unknown reason
1976not ok 512 # TODO [re_tests:512] unknown reason
1977not ok 515 # TODO [re_tests:515] unknown reason
1978not ok 521 # TODO [re_tests:521] unknown reason
1979not ok 522 # TODO [re_tests:522] unknown reason
1980not ok 523 # TODO [re_tests:523] unknown reason
1981not ok 524 # TODO [re_tests:524] unknown reason
1982not ok 527 # TODO [re_tests:527] unknown reason
1983not ok 528 # TODO [re_tests:528] unknown reason
1984ok 531 # SKIP [re_tests:531] bug or error
1985ok 532 # SKIP [re_tests:532] bug or error
1986not ok 535 # TODO [re_tests:535] unknown reason
1987not ok 536 # TODO [re_tests:536] unknown reason
1988not ok 539 # TODO [re_tests:539] unknown reason
1989not ok 540 # TODO [re_tests:540] unknown reason
1990not ok 541 # TODO [re_tests:541] unknown reason
1991not ok 544 # TODO [re_tests:544] unknown reason
1992not ok 545 # TODO [re_tests:545] unknown reason
1993ok 556 # SKIP [re_tests:556] kills a parrot
1994ok 557 # SKIP [re_tests:557] kills a parrot
1995not ok 559 # TODO [re_tests:559] unknown reason
1996ok 563 # SKIP [re_tests:563] bug or error
1997ok 564 # SKIP [re_tests:564] bug or error
1998ok 566 # SKIP [re_tests:566] bug or error
1999ok 568 # SKIP [re_tests:568] kills a parrot
2000ok 569 # SKIP [re_tests:569] kills a parrot
2001ok 570 # SKIP [re_tests:570] kills a parrot
2002ok 571 # SKIP [re_tests:571] kills a parrot
2003ok 572 # SKIP [re_tests:572] kills a parrot
2004ok 573 # SKIP [re_tests:573] kills a parrot
2005ok 574 # SKIP [re_tests:574] kills a parrot
2006ok 575 # SKIP [re_tests:575] kills a parrot
2007ok 576 # SKIP [re_tests:576] kills a parrot
2008ok 577 # SKIP [re_tests:577] kills a parrot
2009ok 578 # SKIP [re_tests:578] kills a parrot
2010ok 579 # SKIP [re_tests:579] kills a parrot
2011ok 580 # SKIP [re_tests:580] kills a parrot
2012ok 581 # SKIP [re_tests:581] kills a parrot
2013ok 582 # SKIP [re_tests:582] kills a parrot
2014ok 583 # SKIP [re_tests:583] kills a parrot
2015ok 584 # SKIP [re_tests:584] kills a parrot
2016ok 585 # SKIP [re_tests:585] kills a parrot
2017ok 586 # SKIP [re_tests:586] kills a parrot
2018ok 587 # SKIP [re_tests:587] kills a parrot
2019ok 588 # SKIP [re_tests:588] kills a parrot
2020ok 589 # SKIP [re_tests:589] kills a parrot
2021ok 590 # SKIP [re_tests:590] kills a parrot
2022ok 591 # SKIP [re_tests:591] kills a parrot
2023ok 592 # SKIP [re_tests:592] kills a parrot
2024ok 593 # SKIP [re_tests:593] bug or error
2025ok 594 # SKIP [re_tests:594] bug or error
2026not ok 595 # TODO [re_tests:595] unknown reason
2027not ok 596 # TODO [re_tests:596] unknown reason
2028ok 597 # SKIP [re_tests:597] unknown reason
2029ok 598 # SKIP [re_tests:598] bug or error
2030ok 599 # SKIP [re_tests:599] bug or error
2031not ok 600 # TODO [re_tests:600] unknown reason
2032not ok 601 # TODO [re_tests:601] unknown reason
2033not ok 603 # TODO [re_tests:603] unknown reason
2034not ok 604 # TODO [re_tests:604] unknown reason
2035not ok 606 # TODO [re_tests:606] unknown reason
2036not ok 607 # TODO [re_tests:607] unknown reason
2037ok 609 # SKIP [re_tests:609] unknown reason
2038ok 610 # SKIP [re_tests:610] unknown reason
2039ok 611 # SKIP [re_tests:611] unknown reason
2040ok 612 # SKIP [re_tests:612] unknown reason
2041ok 613 # SKIP [re_tests:613] unknown reason
2042ok 614 # SKIP [re_tests:614] unknown reason
2043ok 615 # SKIP [re_tests:615] unknown reason
2044ok 616 # SKIP [re_tests:616] unknown reason
2045ok 617 # SKIP [re_tests:617] unknown reason
2046not ok 621 # TODO [re_tests:621] unknown reason
2047not ok 623 # TODO [re_tests:623] unknown reason
2048not ok 624 # TODO [re_tests:624] unknown reason
2049not ok 625 # TODO [re_tests:625] unknown reason
2050ok 627 # SKIP [re_tests:627] unknown reason
2051ok 628 # SKIP [re_tests:628] unknown reason
2052ok 629 # SKIP [re_tests:629] unknown reason
2053ok 630 # SKIP [re_tests:630] unknown reason
2054ok 631 # SKIP [re_tests:631] unknown reason
2055ok 632 # SKIP [re_tests:632] unknown reason
2056ok 633 # SKIP [re_tests:633] unknown reason
2057ok 634 # SKIP [re_tests:634] unknown reason
2058ok 635 # SKIP [re_tests:635] unknown reason
2059not ok 639 # TODO [re_tests:639] unknown reason
2060not ok 641 # TODO [re_tests:641] unknown reason
2061not ok 642 # TODO [re_tests:642] unknown reason
2062not ok 643 # TODO [re_tests:643] unknown reason
2063ok 645 # SKIP [re_tests:645] unknown reason
2064ok 646 # SKIP [re_tests:646] unknown reason
2065ok 647 # SKIP [re_tests:647] unknown reason
2066ok 648 # SKIP [re_tests:648] unknown reason
2067ok 649 # SKIP [re_tests:649] unknown reason
2068ok 650 # SKIP [re_tests:650] unknown reason
2069ok 651 # SKIP [re_tests:651] unknown reason
2070ok 652 # SKIP [re_tests:652] unknown reason
2071ok 653 # SKIP [re_tests:653] unknown reason
2072ok 663 # SKIP [re_tests:663] unknown reason
2073ok 664 # SKIP [re_tests:664] unknown reason
2074ok 665 # SKIP [re_tests:665] unknown reason
2075ok 666 # SKIP [re_tests:666] unknown reason
2076ok 667 # SKIP [re_tests:667] unknown reason
2077ok 668 # SKIP [re_tests:668] unknown reason
2078ok 669 # SKIP [re_tests:669] unknown reason
2079ok 670 # SKIP [re_tests:670] unknown reason
2080ok 671 # SKIP [re_tests:671] unknown reason
2081ok 681 # SKIP [re_tests:681] unknown reason
2082ok 682 # SKIP [re_tests:682] unknown reason
2083ok 683 # SKIP [re_tests:683] unknown reason
2084ok 684 # SKIP [re_tests:684] unknown reason
2085ok 685 # SKIP [re_tests:685] unknown reason
2086ok 686 # SKIP [re_tests:686] unknown reason
2087ok 687 # SKIP [re_tests:687] unknown reason
2088ok 688 # SKIP [re_tests:688] unknown reason
2089ok 689 # SKIP [re_tests:689] unknown reason
2090not ok 693 # TODO [re_tests:693] unknown reason
2091not ok 695 # TODO [re_tests:695] unknown reason
2092not ok 696 # TODO [re_tests:696] unknown reason
2093not ok 697 # TODO [re_tests:697] unknown reason
2094ok 699 # SKIP [re_tests:699] unknown reason
2095ok 700 # SKIP [re_tests:700] unknown reason
2096ok 701 # SKIP [re_tests:701] unknown reason
2097ok 702 # SKIP [re_tests:702] unknown reason
2098ok 703 # SKIP [re_tests:703] unknown reason
2099ok 704 # SKIP [re_tests:704] unknown reason
2100ok 705 # SKIP [re_tests:705] unknown reason
2101ok 706 # SKIP [re_tests:706] unknown reason
2102ok 707 # SKIP [re_tests:707] unknown reason
2103ok 717 # SKIP [re_tests:717] unknown reason
2104ok 718 # SKIP [re_tests:718] unknown reason
2105ok 719 # SKIP [re_tests:719] unknown reason
2106ok 720 # SKIP [re_tests:720] unknown reason
2107ok 721 # SKIP [re_tests:721] unknown reason
2108ok 722 # SKIP [re_tests:722] unknown reason
2109ok 723 # SKIP [re_tests:723] unknown reason
2110ok 724 # SKIP [re_tests:724] unknown reason
2111ok 725 # SKIP [re_tests:725] unknown reason
2112ok 735 # SKIP [re_tests:735] unknown reason
2113ok 736 # SKIP [re_tests:736] unknown reason
2114ok 737 # SKIP [re_tests:737] unknown reason
2115ok 738 # SKIP [re_tests:738] unknown reason
2116ok 739 # SKIP [re_tests:739] unknown reason
2117ok 740 # SKIP [re_tests:740] unknown reason
2118ok 741 # SKIP [re_tests:741] unknown reason
2119ok 742 # SKIP [re_tests:742] unknown reason
2120ok 743 # SKIP [re_tests:743] unknown reason
2121not ok 747 # TODO [re_tests:747] unknown reason
2122not ok 749 # TODO [re_tests:749] unknown reason
2123not ok 750 # TODO [re_tests:750] unknown reason
2124not ok 751 # TODO [re_tests:751] unknown reason
2125ok 753 # SKIP [re_tests:753] unknown reason
2126ok 754 # SKIP [re_tests:754] unknown reason
2127ok 755 # SKIP [re_tests:755] unknown reason
2128ok 756 # SKIP [re_tests:756] unknown reason
2129ok 757 # SKIP [re_tests:757] unknown reason
2130ok 758 # SKIP [re_tests:758] unknown reason
2131ok 759 # SKIP [re_tests:759] unknown reason
2132ok 760 # SKIP [re_tests:760] unknown reason
2133ok 761 # SKIP [re_tests:761] unknown reason
2134ok 771 # SKIP [re_tests:771] unknown reason
2135ok 772 # SKIP [re_tests:772] unknown reason
2136ok 773 # SKIP [re_tests:773] unknown reason
2137ok 774 # SKIP [re_tests:774] unknown reason
2138ok 775 # SKIP [re_tests:775] unknown reason
2139ok 776 # SKIP [re_tests:776] unknown reason
2140ok 777 # SKIP [re_tests:777] unknown reason
2141ok 778 # SKIP [re_tests:778] unknown reason
2142ok 779 # SKIP [re_tests:779] unknown reason
2143ok 789 # SKIP [re_tests:789] unknown reason
2144ok 790 # SKIP [re_tests:790] unknown reason
2145ok 791 # SKIP [re_tests:791] unknown reason
2146ok 792 # SKIP [re_tests:792] unknown reason
2147ok 793 # SKIP [re_tests:793] unknown reason
2148ok 794 # SKIP [re_tests:794] unknown reason
2149ok 795 # SKIP [re_tests:795] unknown reason
2150ok 796 # SKIP [re_tests:796] unknown reason
2151ok 797 # SKIP [re_tests:797] unknown reason
2152ok 800 # SKIP [re_tests:800]
2153not ok 801 # TODO [re_tests:801] unknown reason
2154ok 802 # SKIP [re_tests:802]
2155ok 803 # SKIP [re_tests:803]
2156ok 805 # SKIP [re_tests:805]
2157ok 806 # SKIP [re_tests:806] hangs a parrot
2158ok 807 # SKIP [re_tests:807] hangs a parrot
2159ok 808 # SKIP [re_tests:808] hangs a parrot
2160ok 809 # SKIP [re_tests:809] hangs a parrot
2161ok 810 # SKIP [re_tests:810] hangs a parrot
2162ok 811 # SKIP [re_tests:811] hangs a parrot
2163ok 812 # SKIP [re_tests:812] hangs a parrot
2164ok 813 # SKIP [re_tests:813] hangs a parrot
2165ok 814 # SKIP [re_tests:814] hangs a parrot
2166ok 815 # SKIP [re_tests:815] hangs a parrot
2167ok 816 # SKIP [re_tests:816] hangs a parrot
2168ok 817 # SKIP [re_tests:817] hangs a parrot
2169ok 818 # SKIP [re_tests:818] hangs a parrot
2170ok 819 # SKIP [re_tests:819] hangs a parrot
2171ok 820 # SKIP [re_tests:820] hangs a parrot
2172ok 821 # SKIP [re_tests:821] hangs a parrot
2173ok 822 # SKIP [re_tests:822] hangs a parrot
2174ok 823 # SKIP [re_tests:823] hangs a parrot
2175not ok 827 # TODO [re_tests:827] \d in character class
2176ok 828 # SKIP [re_tests:828]
2177ok 829 # SKIP [re_tests:829]
2178ok 830 # SKIP [re_tests:830]
2179ok 834 # SKIP [re_tests:834]
2180ok 835 # SKIP [re_tests:835]
2181ok 836 # SKIP [re_tests:836]
2182ok 838 # SKIP [re_tests:838]
2183not ok 858 # TODO [re_tests:858] unknown reason
2184ok 859 # SKIP [re_tests:859]
2185ok 862 # SKIP [re_tests:862]
2186not ok 865 # TODO [re_tests:865] unknown reason
2187not ok 866 # TODO [re_tests:866] unknown reason
2188ok 877 # SKIP [re_tests:877]
2189ok 879 # SKIP [re_tests:879] [ID 20010811.006]
2190not ok 881 # TODO [re_tests:881] unknown reason
2191ok 886 # SKIP [re_tests:886]
2192not ok 887 # TODO [re_tests:887] unknown reason
2193not ok 888 # TODO [re_tests:888] unknown reason
2194not ok 890 # TODO [re_tests:890] unknown reason
2195not ok 891 # TODO [re_tests:891] unknown reason
2196not ok 893 # TODO [re_tests:893] unknown reason
2197not ok 896 # TODO [re_tests:896] unknown reason
2198not ok 897 # TODO [re_tests:897] unknown reason
2199not ok 898 # TODO [re_tests:898] unknown reason
2200not ok 899 # TODO [re_tests:899] unknown reason
2201not ok 901 # TODO [re_tests:901] greediness/lookbehind
2202not ok 904 # TODO [re_tests:904] greediness/lookbehind
2203not ok 905 # TODO [re_tests:905] greediness/lookbehind
2204not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion
2205not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion
2206not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion
2207not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion
2208not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion
2209not ok 915 # TODO [re_tests:915] non-greedy/lookbehind
2210not ok 916 # TODO [re_tests:916] non-greedy/lookbehind
2211not ok 918 # TODO [re_tests:918] non-greedy/lookbehind
2212not ok 921 # TODO [re_tests:921] non-greedy/lookbehind
2213not ok 922 # TODO [re_tests:922] non-greedy/lookbehind
2214not ok 923 # TODO [re_tests:923] unmatched bracket
2215ok 924 # SKIP [re_tests:924]
2216ok 926 # SKIP [re_tests:926] [perl #18019]
2217not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171]
2218not ok 928 # TODO [re_tests:928] reuse captured group
2219not ok 929 # TODO [re_tests:929] reuse captured group
2220not ok 930 # TODO [re_tests:930] reuse captured group
2221not ok 931 # TODO [re_tests:931] reuse captured group
2222not ok 932 # TODO [re_tests:932] reuse captured group
2223not ok 933 # TODO [re_tests:933] reuse captured group
2224not ok 934 # TODO [re_tests:934] reuse captured group
2225not ok 935 # TODO [re_tests:935] reuse captured group
2226not ok 936 # TODO [re_tests:936] reuse captured group
2227not ok 937 # TODO [re_tests:937] reuse captured group
2228not ok 938 # TODO [re_tests:938] reuse captured group
2229not ok 939 # TODO [re_tests:939] reuse captured group
2230not ok 940 # TODO [re_tests:940] reuse captured group
2231not ok 941 # TODO [re_tests:941] reuse captured group
2232not ok 942 # TODO [re_tests:942] reuse captured group
2233ok 944 # SKIP [re_tests:944] unknown reason
2234ok 945 # SKIP [re_tests:945] unknown reason
2235ok 957 # SKIP [re_tests:957]
2236ok 958 # SKIP [re_tests:958]
2237not ok 959 # TODO [re_tests:959] [perl #34195]
2238not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion
2239ok
2240t/compilers/pge/perl6regex/01-regex....
2241not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&|) - parse error
2242not ok 99 # TODO [rx_metachars:114] null pattern invalid
2243not ok 386 # TODO [rx_backtrack:4] basic
2244not ok 427 # TODO [rx_charclass:26] illegal character range
2245not ok 458 # TODO [rx_charclass:62] literal match (\")
2246not ok 459 # TODO [rx_charclass:64] literal match (\")
2247not ok 460 # TODO [rx_charclass:66] literal match with quote
2248not ok 461 # TODO [rx_charclass:68] literal match with quote
2249not ok 462 # TODO [rx_charclass:70] literal match with backslash
2250not ok 463 # TODO [rx_charclass:72] literal match with interpolation
2251not ok 464 # TODO [rx_charclass:74] literal match with interpolation
2252not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i)
2253not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s)
2254not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s)
2255not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s)
2256not ok 709 # TODO [rx_modifiers:131] basic ws match
2257not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5)
2258not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth)
2259not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth)
2260ok
2261t/compilers/pge/perl6regex/context.....
2262not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented
2263ok
2264t/compilers/tge/basic..................ok
2265t/compilers/tge/grammar................
2266not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug
2267ok
2268t/compilers/tge/parser.................ok
2269t/library/cgi_query_hash...............ok
2270t/library/coroutine....................ok
2271t/library/dumper.......................ok
2272t/library/getopt_obj...................ok
2273t/library/hllmacros....................ok
2274t/library/iter.........................ok
2275t/library/md5..........................ok
2276t/library/mime_base64..................ok
2277t/library/mt19937ar....................ok
2278t/library/p6object.....................
2279not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) >
2280ok
2281t/library/parrotlib....................ok
2282t/library/pcre.........................
2283ok 1 # SKIP no pcre-config
2284ok
2285t/library/pg...........................
2286ok 1 # SKIP skipped
2287ok 2 # SKIP skipped
2288ok 3 # SKIP skipped
2289ok 4 # SKIP skipped
2290ok 5 # SKIP skipped
2291ok 6 # SKIP skipped
2292ok 7 # SKIP skipped
2293ok 8 # SKIP skipped
2294ok 9 # SKIP skipped
2295ok 10 # SKIP skipped
2296ok 11 # SKIP skipped
2297ok 12 # SKIP skipped
2298ok 13 # SKIP skipped
2299ok 14 # SKIP skipped
2300ok 15 # SKIP skipped
2301ok 16 # SKIP skipped
2302ok 17 # SKIP skipped
2303ok 18 # SKIP skipped
2304ok 19 # SKIP skipped
2305ok 20 # SKIP skipped
2306ok 21 # SKIP skipped
2307ok 22 # SKIP skipped
2308ok 23 # SKIP skipped
2309ok 24 # SKIP skipped
2310ok 25 # SKIP skipped
2311ok 26 # SKIP skipped
2312ok 27 # SKIP skipped
2313ok 28 # SKIP skipped
2314ok 29 # SKIP skipped
2315ok 30 # SKIP skipped
2316ok 31 # SKIP skipped
2317ok 32 # SKIP skipped
2318ok 33 # SKIP skipped
2319ok 34 # SKIP skipped
2320ok 35 # SKIP skipped
2321ok 36 # SKIP skipped
2322ok 37 # SKIP skipped
2323ok 38 # SKIP skipped
2324ok 39 # SKIP skipped
2325ok 40 # SKIP skipped
2326ok 41 # SKIP skipped
2327ok 42 # SKIP skipped
2328ok 43 # SKIP skipped
2329ok
2330t/library/protoobject..................ok
2331t/library/rand.........................ok
2332t/library/range........................ok
2333t/library/streams......................
2334ok 18 # SKIP broken method invocation
2335ok 20 # SKIP broken method invocation
2336ok
2337t/library/string_utils.................ok
2338t/library/tcl_glob.....................ok
2339t/library/tcl_lib......................ok
2340t/library/test_builder_tester..........ok
2341t/library/test_class...................ok
2342t/library/test_more....................ok
2343t/library/uuid.........................ok
2344t/library/yaml_dumper..................
2345not ok 7 - properties # TODO not yet implemented
2346not ok 8 - indent string # TODO not supported
2347not ok 9 - back-referencing properties # TODO not yet implemented
2348not ok 10 - self-referential properties (1) # TODO not yet implemented
2349not ok 11 - self-referential properties (2) # TODO not yet implemented
2350not ok 26 - custom dumper # TODO not yet implemented
2351ok
2352t/library/yaml_parser_syck.............
2353not ok 1 - basic parsing # TODO Not properly implemented yet
2354ok
2355All tests successful.
2356
2357Test Summary Report
2358-------------------
2359t/pmc/exception                    (Wstat: 0 Tests: 31 Failed: 0)
2360  TODO passed:   30
2361Files=252, Tests=8326, 459 wallclock secs ( 6.10 usr  4.04 sys + 188.72 cusr 114.40 csys = 313.26 CPU)
2362Result: PASS
2363perl t/harness --gc-debug --running-make-test -f --runcore-tests
2364t/compilers/imcc/imcpasm/cfg...........ok
2365t/compilers/imcc/imcpasm/opt0..........
2366ok 1 # SKIP disabled graph coloring register allocator, RT #57028
2367ok 3 # SKIP disabled graph coloring register allocator, RT #57028
2368ok
2369t/compilers/imcc/imcpasm/opt1..........
2370ok 76 # SKIP constant concat N/Y
2371ok
2372t/compilers/imcc/imcpasm/opt2..........
2373ok 5 # SKIP loop opt disabled for now
2374ok
2375t/compilers/imcc/imcpasm/optc..........
2376not ok 9 - tailcall 1 # TODO RT #57028
2377ok
2378t/compilers/imcc/imcpasm/pcc...........ok
2379t/compilers/imcc/imcpasm/sub...........ok
2380t/compilers/imcc/reg/alloc.............ok
2381t/compilers/imcc/reg/spill.............ok
2382t/compilers/imcc/syn/bsr...............ok
2383t/compilers/imcc/syn/clash.............
2384not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet
2385ok
2386t/compilers/imcc/syn/const.............ok
2387t/compilers/imcc/syn/errors............ok
2388t/compilers/imcc/syn/eval..............
2389ok 1 # SKIP changed eval semantics - see t/pmc/eval.t
2390ok 2 # SKIP changed eval semantics - see t/pmc/eval.t
2391ok 3 # SKIP changed eval semantics - see t/pmc/eval.t
2392ok 4 # SKIP changed eval semantics - see t/pmc/eval.t
2393ok 5 # SKIP changed eval semantics - see t/pmc/eval.t
2394ok 6 # SKIP changed eval semantics - see t/pmc/eval.t
2395ok 7 # SKIP changed eval semantics - see t/pmc/eval.t
2396ok
2397t/compilers/imcc/syn/file..............
2398ok 13 # SKIP multiple loading not speced - failing
2399ok
2400t/compilers/imcc/syn/hll...............ok
2401t/compilers/imcc/syn/keyed.............
2402ok 1 # SKIP experimental
2403ok
2404t/compilers/imcc/syn/labels............ok
2405t/compilers/imcc/syn/macro.............
2406not ok 25 - unterminated macro 2 # TODO Darwin segfault -- RT #60926
2407ok
2408t/compilers/imcc/syn/objects...........ok
2409t/compilers/imcc/syn/op................ok
2410t/compilers/imcc/syn/pasm..............ok
2411t/compilers/imcc/syn/pcc...............ok
2412t/compilers/imcc/syn/pod...............
2413ok 4 # SKIP Closing out of pod from included files
2414ok
2415t/compilers/imcc/syn/regressions.......
2416not ok 4 - comments between .param(RT \#46499) # TODO broken
2417not ok 6 - whitespace between .param(RT \#46499) # TODO broken
2418not ok 7 - off by one error message (RT \#40204) # TODO broken
2419ok
2420t/compilers/imcc/syn/scope.............ok
2421t/compilers/imcc/syn/subflags..........
2422not ok 15 # TODO :method sub not found in namespace
2423ok
2424t/compilers/imcc/syn/symbols...........ok
2425t/compilers/imcc/syn/tail..............ok
2426t/compilers/imcc/syn/veracity..........ok
2427t/op/00ff-dos..........................ok
2428t/op/00ff-unix.........................ok
2429t/op/01-parse_ops......................ok
2430t/op/64bit.............................
24311..0 # Skip 64bit INTVAL platforms only
2432skipped: 64bit INTVAL platforms only
2433t/op/annotate..........................ok
2434t/op/arithmetics.......................
2435ok 28 # SKIP No integer overflow for 32-bit INTVALs without GMP installed
2436ok
2437t/op/basic.............................ok
2438t/op/bitwise...........................
2439ok 27 # SKIP no BigInt lib found
2440ok
2441t/op/box...............................ok
2442t/op/calling...........................
2443not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all
2444not ok 93 - arg mismatch with no params # TODO RT #39844
2445ok
2446t/op/cc_params.........................ok
2447t/op/cc_state..........................
2448not ok 6 - positional found, named expected # TODO cc processor state missing
2449not ok 8 - G2: argument underflow: required slurpy param # TODO failing
2450ok
2451t/op/cmp-nonbranch.....................ok
2452t/op/comp..............................ok
2453t/op/copy..............................ok
2454t/op/debuginfo.........................
2455ok 1 # SKIP disabled on fast-core
2456ok 7 # SKIP disabled on this core
2457ok 8 # SKIP disabled on this core
2458ok
2459t/op/exceptions........................
2460not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans
2461ok
2462t/op/gc................................ok
2463t/op/globals...........................ok
2464t/op/hacks.............................
2465ok 1 # SKIP no universal SIGFPE handling
2466ok 2 # SKIP no universal SIGFPE handling
2467ok
2468t/op/ifunless..........................ok
2469t/op/integer...........................ok
2470t/op/interp............................
2471ok 1 # SKIP we really shouldn't run just a label - use a sub
2472ok
2473t/op/io................................ok
2474t/op/jit...............................ok
2475t/op/jitn..............................ok
2476t/op/lexicals..........................
2477not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented
2478ok
2479t/op/literal...........................ok
2480t/op/load_bytecode.....................ok
2481t/op/number............................ok
2482t/op/pushaction........................
2483not ok 7 - pushaction: error while handling error # TODO runloop shenanigans
2484ok
2485t/op/say...............................ok
2486t/op/spawnw............................ok
2487t/op/sprintf...........................
2488ok 5 # SKIP parrot extension (%B)
2489ok 7 # SKIP perl5-specific extension (%D)
2490ok 9 # SKIP perl5-specific extension (%F)
2491ok 16 # SKIP parrot extension (%H)
2492ok 20 # SKIP parrot extension (%L)
2493ok 23 # SKIP perl5-specific extension (%O)
2494ok 24 # SKIP parrot extension (%P)
2495ok 27 # SKIP parrot extension (%S)
2496ok 29 # SKIP perl5-specific extension (%U)
2497not ok 64 # TODO [%03.2d]  actual: > 01<
2498ok 71 # SKIP perl5-specific extension (%v...)
2499ok 72 # SKIP perl5-specific extension (%v...)
2500ok 73 # SKIP perl5-specific extension (%v...)
2501ok 74 # SKIP perl5-specific extension (%v...)
2502ok 75 # SKIP perl5-specific extension (%v...)
2503ok 76 # SKIP perl5-specific extension (%v...)
2504ok 77 # SKIP perl5-specific extension (%v...)
2505ok 78 # SKIP perl5-specific extension (%v...)
2506ok 79 # SKIP perl5-specific extension (%v...)
2507ok 80 # SKIP perl5-specific extension (%v...)
2508ok 81 # SKIP perl5-specific extension (%v...)
2509ok 82 # SKIP perl5-specific extension (%v...)
2510ok 83 # SKIP perl5-specific extension (%v...)
2511ok 84 # SKIP perl5-specific extension (%v...)
2512ok 85 # SKIP perl5-specific extension (%v...)
2513ok 86 # SKIP perl5-specific extension (%v...)
2514ok 87 # SKIP perl5-specific extension (%v...)
2515ok 88 # SKIP perl5-specific extension (%v...)
2516ok 89 # SKIP perl5-specific extension (%v...)
2517ok 90 # SKIP perl5-specific extension (%v...)
2518ok 91 # SKIP perl5-specific extension (%v...)
2519ok 92 # SKIP perl5-specific extension (%v...)
2520ok 93 # SKIP perl5-specific extension (%v...)
2521ok 94 # SKIP perl5-specific extension (%v...)
2522ok 95 # SKIP perl5-specific extension (%v...)
2523ok 96 # SKIP perl5-specific extension (%v...)
2524ok 97 # SKIP perl5-specific extension (%v...)
2525ok 98 # SKIP perl5-specific extension (%v...)
2526ok 99 # SKIP perl5-specific extension (%v...)
2527ok 114 # SKIP harness needs support for * modifier
2528ok 131 # SKIP harness needs support for * modifier
2529ok 141 # SKIP harness needs support for * modifier
2530ok 144 # SKIP perl5 expresssion as test value
2531not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1<
2532ok 161 # SKIP harness needs support for * modifier
2533ok 166 # SKIP harness needs support for * modifier
2534not ok 187 # TODO [%h]  actual: ><
2535not ok 191 # TODO [%l]  actual: ><
2536ok 193 # SKIP perl5-specific test
2537ok 200 # SKIP perl5-specific test
2538ok 201 # SKIP perl5-specific test
2539ok 202 # SKIP parrot extension (%p)
2540ok 204 # SKIP parrot extension (%r)
2541ok 210 # SKIP harness needs support for * modifier
2542ok 214 # SKIP harness needs support for * modifier
2543not ok 223 # TODO [%v]  actual: ><
2544ok 233 # SKIP harness needs support for * modifier
2545ok 234 # SKIP perl5-specific extension (%v...)
2546ok 235 # SKIP perl5-specific extension (%v...)
2547ok 238 # SKIP perl5-specific test
2548ok 239 # SKIP perl5-specific test
2549ok 240 # SKIP perl5-specific test
2550ok 241 # SKIP perl5-specific test
2551ok 242 # SKIP perl5-specific test
2552ok 243 # SKIP perl5-specific test
2553ok 244 # SKIP perl5-specific test
2554ok 245 # SKIP perl5-specific test
2555ok 246 # SKIP perl5-specific test
2556ok 247 # SKIP perl5-specific test
2557ok 248 # SKIP perl5-specific test
2558ok 249 # SKIP perl5-specific test
2559ok 250 # SKIP perl5-specific test
2560ok 251 # SKIP perl5-specific test
2561ok 252 # SKIP perl5-specific extension (%v...)
2562ok 253 # SKIP perl5-specific extension (%v...)
2563ok 254 # SKIP perl5-specific extension (%v...)
2564ok 255 # SKIP perl5-specific extension (%v...)
2565ok 256 # SKIP perl5-specific extension (%v...)
2566ok 257 # SKIP perl5-specific extension (%v...)
2567ok 258 # SKIP perl5-specific extension (%v...)
2568ok 259 # SKIP perl5-specific extension (%v...)
2569ok 260 # SKIP perl5-specific extension (%v...)
2570ok 261 # SKIP perl5-specific extension (%v...)
2571ok 262 # SKIP perl5-specific extension (%v...)
2572ok 263 # SKIP perl5-specific extension (%v...)
2573ok 264 # SKIP perl5-specific extension (%v...)
2574ok 265 # SKIP perl5-specific extension (%v...)
2575ok 266 # SKIP perl5-specific extension (%v...)
2576ok 267 # SKIP perl5-specific extension (%v...)
2577ok 268 # SKIP perl5-specific extension (%v...)
2578ok 269 # SKIP perl5-specific extension (%v...)
2579ok 270 # SKIP perl5-specific extension (%v...)
2580ok 271 # SKIP perl5-specific extension (%v...)
2581ok 272 # SKIP perl5-specific extension (%v...)
2582ok 273 # SKIP perl5-specific extension (%v...)
2583ok 274 # SKIP perl5-specific extension (%v...)
2584ok 275 # SKIP perl5-specific extension (%v...)
2585ok 276 # SKIP perl5-specific extension (%v...)
2586ok 277 # SKIP perl5-specific extension (%v...)
2587ok 278 # SKIP perl5-specific extension (%v...)
2588ok 279 # SKIP perl5-specific extension (%v...)
2589ok 280 # SKIP perl5-specific extension (%v...)
2590ok 281 # SKIP perl5-specific extension (%v...)
2591ok 282 # SKIP perl5-specific extension (%v...)
2592ok 283 # SKIP perl5-specific extension (%v...)
2593ok 284 # SKIP perl5-specific extension (%v...)
2594ok 285 # SKIP perl5-specific extension (%v...)
2595ok 286 # SKIP perl5-specific extension (%v...)
2596ok 287 # SKIP perl5-specific extension (%v...)
2597ok 288 # SKIP perl5-specific extension (%v...)
2598ok 289 # SKIP perl5-specific extension (%v...)
2599ok 290 # SKIP perl5-specific extension (%v...)
2600ok 291 # SKIP perl5-specific extension (%v...)
2601ok 292 # SKIP perl5-specific extension (%v...)
2602ok 293 # SKIP perl5-specific extension (%v...)
2603ok 294 # SKIP perl5-specific extension (%v...)
2604ok 295 # SKIP perl5-specific extension (%v...)
2605ok 296 # SKIP perl5-specific extension (%v...)
2606ok 297 # SKIP perl5-specific extension (%v...)
2607ok 298 # SKIP perl5-specific extension (%v...)
2608ok 300 # SKIP harness needs support for * modifier
2609not ok 304 # TODO [%#b]  actual: >0b0<
2610not ok 305 # TODO [%#o]  actual: >00<
2611not ok 306 # TODO [%#x]  actual: >0x0<
2612ok 307 # SKIP perl5-specific extension (%v...)
2613ok 308 # SKIP perl5-specific extension (%v...)
2614ok
2615t/op/sprintf2..........................ok
2616t/op/string............................
2617ok 103 # SKIP Pending rework of creating non-ascii literals
2618ok 104 # SKIP Pending rework of creating non-ascii literals
2619ok 118 # SKIP Pending reimplementation of find_encoding
2620ok 119 # SKIP no more visible encoding
2621ok 137 # SKIP No unicode yet
2622ok 139 # SKIP no more transcode
2623ok 140 # SKIP no more chartype
2624ok
2625t/op/string_cclass.....................
2626ok 7 # SKIP unicode support unavailable
2627ok 8 # SKIP unicode support unavailable
2628ok 9 # SKIP unicode support unavailable
2629ok
2630t/op/string_cs.........................
2631ok 31 # SKIP no ICU lib
2632ok 32 # SKIP no ICU lib
2633ok 33 # SKIP no ICU lib
2634ok 34 # SKIP no ICU lib
2635ok 35 # SKIP no ICU lib
2636ok 36 # SKIP no ICU lib
2637ok 37 # SKIP no ICU lib
2638ok 38 # SKIP no ICU lib
2639ok 39 # SKIP no ICU lib
2640ok 40 # SKIP no ICU lib
2641ok 41 # SKIP no ICU lib
2642ok 42 # SKIP no ICU lib
2643ok 43 # SKIP no ICU lib
2644ok 44 # SKIP no ICU lib
2645ok 45 # SKIP no ICU lib
2646ok 46 # SKIP no ICU lib
2647ok
2648t/op/string_mem........................ok
2649t/op/stringu...........................
2650ok 20 # SKIP no ICU lib
2651ok 21 # SKIP no ICU lib
2652ok 22 # SKIP no ICU lib
2653ok 25 # SKIP Tests seem to fail on big endian machines with icu
2654ok 26 # SKIP Tests seem to fail on big endian machines with icu
2655not ok 27 - UTF-8 and Unicode literals # TODO TT #24
2656ok
2657t/op/sysinfo...........................
2658not ok 11 - sysinfo OS version string # TODO Not Currently Implemented
2659not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented
2660ok 13 # SKIP Requires a lot of work to find out the correct answer
2661ok 14 # SKIP Testing only in some known platforms
2662ok
2663t/op/time..............................ok
2664t/op/trans.............................ok
2665t/pmc/addrregistry.....................ok
2666t/pmc/array............................
2667not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken
2668ok
2669t/pmc/bigint...........................
26701..0 # Skip No BigInt Lib configured
2671skipped: No BigInt Lib configured
2672t/pmc/bignum...........................
26731..0 # Skip No BigNum PMC enabled
2674skipped: No BigNum PMC enabled
2675t/pmc/boolean..........................ok
2676t/pmc/bound_nci........................ok
2677t/pmc/callsignature....................ok
2678t/pmc/capture..........................ok
2679t/pmc/class............................
2680not ok 28 # TODO add_method() invoking method added to class works
2681ok
2682t/pmc/codestring.......................ok
2683t/pmc/complex..........................
2684ok 58 # SKIP div by zero not caught
2685ok 59 # SKIP div by zero not caught
2686ok 60 # SKIP div by zero not caught
2687ok 86 # SKIP instantiate n/y
2688ok 87 # SKIP instantiate n/y
2689ok 88 # SKIP instantiate n/y
2690ok 89 # SKIP instantiate n/y
2691ok 126 # SKIP inf is not platform-independent
2692ok 465 # SKIP add using subclass of Complex - RT #59630
2693ok 466 # SKIP add using subclass of Complex - RT #59630
2694ok 467 # SKIP add using subclass of Complex - RT #59630
2695ok
2696t/pmc/config...........................ok
2697t/pmc/continuation.....................ok
2698t/pmc/coroutine........................
2699not ok 9 - Call an exited coroutine # TODO goes one iteration too far.
2700ok
2701t/pmc/cpointer.........................ok
2702t/pmc/default..........................
2703not ok 1 - new # TODO not implemeted
2704ok
2705t/pmc/env..............................ok
2706t/pmc/eval.............................ok
2707t/pmc/eventhandler.....................ok
2708t/pmc/exception........................
2709not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans
2710not ok 25 - pushaction: error while handling error # TODO runloop shenanigans
2711not ok 27 - invoke handler in calling sub # TODO deprecate rethrow
2712not ok 30 - catch ex from C-level MULTI function # TODO broken
2713ok
2714t/pmc/exceptionhandler.................ok
2715t/pmc/exporter.........................ok
2716t/pmc/file.............................ok
2717t/pmc/filehandle.......................
2718ok 3 # SKIP no asynch calls yet
2719not ok 8 - record_separator # TODO not yet implemented
2720ok
2721t/pmc/fixedbooleanarray................ok
2722t/pmc/fixedfloatarray..................ok
2723t/pmc/fixedintegerarray................ok
2724t/pmc/fixedpmcarray....................ok
2725t/pmc/fixedstringarray.................ok
2726t/pmc/float............................ok
2727t/pmc/freeze...........................ok
2728t/pmc/globals..........................ok
2729t/pmc/hash.............................ok
2730t/pmc/integer..........................ok
2731t/pmc/io...............................
2732not ok 1 - IO on some invalid types # TODO IO on some invalid types
2733ok 8 # SKIP clone not finished yet
2734not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433
2735not ok 40 - string read/write handle # TODO no stringhandle yet
2736ok
2737t/pmc/io_iterator......................
2738not ok 1 - new # TODO not yet implemented
2739not ok 2 - shift # TODO not yet implemented
2740not ok 3 - get_bool (vtable) # TODO not yet implemented
2741ok
2742t/pmc/io_status........................
2743not ok 1 - new # TODO not yet implemented
2744not ok 2 - get_integer (vtable) # TODO not yet implemented
2745not ok 3 - get_bool (vtable) # TODO not yet implemented
2746not ok 4 - return # TODO not yet implemented
2747not ok 5 - error # TODO not yet implemented
2748not ok 6 - throw # TODO not yet implemented
2749ok
2750t/pmc/iterator.........................
2751ok 13 # SKIP N/Y: length of rest of array
2752not ok 16 - adding keys during iteration # TODO adding keys during iteration
2753not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points'
2754ok
2755t/pmc/key..............................
2756not ok 10 # TODO register and non-register string keys should be COW (RT #60128)
2757ok
2758t/pmc/lexinfo..........................ok
2759t/pmc/lexpad...........................ok
2760t/pmc/managedstruct....................ok
2761t/pmc/multidispatch....................
2762not ok 22 - MMD on PMC types - Any # TODO RT #41374
2763not ok 25 - add as method - inherited # TODO RT #41374
2764not ok 32 - use a core func for an object # TODO RT #59628
2765ok
2766t/pmc/multisub.........................ok
2767t/pmc/namespace........................
2768not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17
2769ok
2770t/pmc/nci..............................ok
2771t/pmc/null.............................ok
2772t/pmc/object-meths.....................
2773ok 14 # SKIP currently broken
2774ok 25 # SKIP no bound NCI method
2775ok
2776t/pmc/object-mro.......................ok
2777t/pmc/object...........................ok
2778t/pmc/objects..........................ok
2779t/pmc/orderedhash......................ok
2780t/pmc/os...............................ok
2781t/pmc/packfile.........................ok
2782t/pmc/packfileconstanttable............
2783not ok 3 - get_type, get_*_keyed_int # TODO See TT #385.
2784ok
2785t/pmc/packfiledirectory................ok
2786t/pmc/packfilefixupentry...............ok
2787t/pmc/packfilefixuptable...............ok
2788t/pmc/packfilerawsegment...............ok
2789t/pmc/packfilesegment..................ok
2790t/pmc/parrotclass......................ok
2791t/pmc/parrotinterpreter................ok
2792t/pmc/parrotio.........................
2793not ok 2 - open and close - synchronous # TODO not yet implemented
2794ok 3 # SKIP no asynch calls yet
2795not ok 4 - print, read, and readline - synchronous # TODO not yet implemented
2796not ok 5 - record_separator # TODO not yet implemented
2797not ok 6 - buffer_type # TODO not yet implemented
2798ok
2799t/pmc/parrotlibrary....................ok
2800t/pmc/parrotobject.....................ok
2801t/pmc/parrotrunningthread..............ok
2802t/pmc/parrotthread.....................ok
2803t/pmc/pccmethod_test...................ok
2804t/pmc/pmc..............................ok
2805t/pmc/pmcproxy.........................ok
2806t/pmc/pointer..........................ok
2807t/pmc/prop.............................ok
2808t/pmc/random...........................ok
2809t/pmc/ref..............................ok
2810t/pmc/resizablebooleanarray............ok
2811t/pmc/resizablefloatarray..............ok
2812t/pmc/resizableintegerarray............ok
2813t/pmc/resizablepmcarray................ok
2814t/pmc/resizablestringarray.............ok
2815t/pmc/retcontinuation..................ok
2816t/pmc/ro...............................
2817not ok 8 - ResizablePMCArray -- Recursive # TODO 1
2818ok
2819t/pmc/role.............................ok
2820t/pmc/scalar...........................
2821ok 1 # SKIP doesn't work yet
2822ok
2823t/pmc/scheduler........................ok
2824t/pmc/schedulermessage.................ok
2825t/pmc/sharedref........................ok
2826t/pmc/signal...........................
28271..0 # Skip Signals currently disabled
2828skipped: Signals currently disabled
2829t/pmc/slice............................
2830not ok 2 - bug with slice bits # TODO parser
2831ok
2832t/pmc/string...........................ok
2833t/pmc/stringhandle.....................
2834ok 3 # SKIP no asynch calls yet
2835not ok 9 - record_separator # TODO not yet implemented
2836ok
2837t/pmc/sub..............................ok
2838t/pmc/sys..............................ok
2839t/pmc/task.............................ok
2840t/pmc/threads..........................
2841not ok 11 - CLONE_CODE | CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511
2842not ok 15 - CLONE_CODE|CLONE_GLOBALS|CLONE_HLL|CLONE_LIBRARIES # TODO RT #41373
2843ok
2844t/pmc/timer............................ok
2845t/pmc/undef............................ok
2846t/pmc/unmanagedstruct..................ok
2847t/oo/attributes........................ok
2848t/oo/composition.......................ok
2849t/oo/inheritance.......................ok
2850t/oo/isa...............................ok
2851t/oo/metamodel.........................
2852not ok 6 # TODO tail attribute has a type
2853not ok 12 # TODO new opcode makes working objects
2854ok
2855t/oo/methods...........................ok
2856t/oo/mro-c3............................ok
2857t/oo/names.............................ok
2858t/oo/new...............................ok
2859t/oo/ops...............................ok
2860t/oo/proxy.............................ok
2861t/oo/subclass..........................ok
2862t/oo/vtableoverride....................ok
2863t/native_pbc/header....................
28641..0 # Skip pending robust testing strategy, TT #357
2865skipped: pending robust testing strategy, TT #357
2866t/native_pbc/integer...................
28671..0 # Skip pending robust testing strategy, TT #357
2868skipped: pending robust testing strategy, TT #357
2869t/native_pbc/number....................
28701..0 # Skip pending robust testing strategy, TT #357
2871skipped: pending robust testing strategy, TT #357
2872t/native_pbc/string....................
28731..0 # Skip pending robust testing strategy, TT #357
2874skipped: pending robust testing strategy, TT #357
2875t/dynpmc/dynlexpad.....................
2876not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads
2877ok
2878t/dynpmc/foo...........................
2879ok 6 # SKIP No BigInt Lib configured
2880ok
2881t/dynpmc/gdbmhash......................
28821..0 # Skip No gdbm library available
2883skipped: No gdbm library available
2884t/dynpmc/md2...........................ok
2885t/dynpmc/md4...........................ok
2886t/dynpmc/md5...........................ok
2887t/dynpmc/pair..........................ok
2888t/dynpmc/rational......................ok
2889t/dynpmc/ripemd160.....................ok
2890t/dynpmc/rotest........................ok
2891t/dynpmc/sha...........................ok
2892t/dynpmc/sha1..........................ok
2893t/dynpmc/sha256........................
28941..0 # Skip Too old library
2895skipped: Too old library
2896t/dynpmc/sha512........................
28971..0 # Skip Too old library
2898skipped: Too old library
2899t/dynpmc/subclass_with_pir_method......
2900not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces
2901not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces
2902ok
2903t/dynpmc/subproxy......................ok
2904t/dynoplibs/dan........................ok
2905t/dynoplibs/myops......................ok
2906t/compilers/pct/complete_workflow......ok
2907t/compilers/pct/past...................ok
2908t/compilers/pct/pct_hllcompiler........ok
2909t/compilers/pct/post...................ok
2910t/compilers/pge/00-basic...............ok
2911t/compilers/pge/02-match...............ok
2912t/compilers/pge/03-optable.............ok
2913t/compilers/pge/04-compile.............ok
2914t/compilers/pge/06-grammar.............ok
2915t/compilers/pge/pge-hs.................ok
2916t/compilers/pge/pge....................ok
2917t/compilers/pge/pge_examples...........ok
2918t/compilers/pge/pge_globs..............ok
2919t/compilers/pge/pge_text...............ok
2920t/compilers/pge/pge_util...............ok
2921t/compilers/pge/p5regex/p5rx...........
2922not ok 116 # TODO [re_tests:116] character class in enumeration
2923not ok 119 # TODO [re_tests:119] character class in enumeration
2924not ok 120 # TODO [re_tests:120] character class in enumeration
2925not ok 123 # TODO [re_tests:123] character class in enumeration
2926not ok 124 # TODO [re_tests:124] character class in enumeration
2927not ok 127 # TODO [re_tests:127] character class in enumeration
2928ok 138 # SKIP [re_tests:138] parser bug
2929ok 139 # SKIP [re_tests:139] broken col 4?
2930ok 143 # SKIP [re_tests:143] bug or error
2931ok 144 # SKIP [re_tests:144] bug or error
2932ok 148 # SKIP [re_tests:148] bug or error
2933ok 149 # SKIP [re_tests:149] bug or error
2934ok 155 # SKIP [re_tests:155] bug or error
2935ok 167 # SKIP [re_tests:167] bug or error
2936not ok 234 # TODO [re_tests:234] unknown reason
2937not ok 235 # TODO [re_tests:235] unknown reason
2938not ok 236 # TODO [re_tests:236] unknown reason
2939not ok 246 # TODO [re_tests:246] unknown reason
2940not ok 247 # TODO [re_tests:247] unknown reason
2941ok 248 # SKIP [re_tests:248] bug or error
2942ok 249 # SKIP [re_tests:249] bug or error
2943ok 252 # SKIP [re_tests:252] bug or error
2944not ok 254 # TODO [re_tests:254] unknown reason
2945not ok 256 # TODO [re_tests:256] unknown reason
2946not ok 257 # TODO [re_tests:257] unknown reason
2947ok 264 # SKIP [re_tests:264] trailing modifiers
2948ok 265 # SKIP [re_tests:265] trailing modifiers
2949ok 266 # SKIP [re_tests:266] trailing modifiers
2950ok 267 # SKIP [re_tests:267] trailing modifiers
2951ok 268 # SKIP [re_tests:268] trailing modifiers
2952ok 269 # SKIP [re_tests:269] trailing modifiers
2953ok 270 # SKIP [re_tests:270] trailing modifiers
2954ok 271 # SKIP [re_tests:271] trailing modifiers
2955ok 272 # SKIP [re_tests:272] trailing modifiers
2956ok 273 # SKIP [re_tests:273] trailing modifiers
2957ok 274 # SKIP [re_tests:274] trailing modifiers
2958ok 275 # SKIP [re_tests:275] trailing modifiers
2959ok 276 # SKIP [re_tests:276] trailing modifiers
2960ok 277 # SKIP [re_tests:277] trailing modifiers
2961ok 278 # SKIP [re_tests:278] trailing modifiers
2962ok 279 # SKIP [re_tests:279] trailing modifiers
2963ok 280 # SKIP [re_tests:280] trailing modifiers
2964ok 281 # SKIP [re_tests:281] trailing modifiers
2965ok 282 # SKIP [re_tests:282] trailing modifiers
2966ok 283 # SKIP [re_tests:283] trailing modifiers
2967ok 284 # SKIP [re_tests:284] trailing modifiers
2968ok 285 # SKIP [re_tests:285] trailing modifiers
2969ok 286 # SKIP [re_tests:286] trailing modifiers
2970ok 287 # SKIP [re_tests:287] trailing modifiers
2971ok 288 # SKIP [re_tests:288] trailing modifiers
2972ok 289 # SKIP [re_tests:289] trailing modifiers
2973ok 290 # SKIP [re_tests:290] trailing modifiers
2974ok 291 # SKIP [re_tests:291] trailing modifiers
2975ok 292 # SKIP [re_tests:292] trailing modifiers
2976ok 293 # SKIP [re_tests:293] trailing modifiers
2977ok 294 # SKIP [re_tests:294] trailing modifiers
2978ok 295 # SKIP [re_tests:295] trailing modifiers
2979ok 296 # SKIP [re_tests:296] trailing modifiers
2980ok 297 # SKIP [re_tests:297] trailing modifiers
2981ok 298 # SKIP [re_tests:298] trailing modifiers
2982ok 299 # SKIP [re_tests:299] trailing modifiers
2983ok 300 # SKIP [re_tests:300] trailing modifiers
2984ok 301 # SKIP [re_tests:301] trailing modifiers
2985ok 302 # SKIP [re_tests:302] trailing modifiers
2986ok 303 # SKIP [re_tests:303] trailing modifiers
2987ok 304 # SKIP [re_tests:304] trailing modifiers
2988ok 305 # SKIP [re_tests:305] trailing modifiers
2989ok 306 # SKIP [re_tests:306] trailing modifiers
2990ok 307 # SKIP [re_tests:307] trailing modifiers
2991ok 308 # SKIP [re_tests:308] bug or error
2992ok 309 # SKIP [re_tests:309] bug or error
2993ok 310 # SKIP [re_tests:310] bug or error
2994ok 311 # SKIP [re_tests:311] trailing modifiers
2995ok 312 # SKIP [re_tests:312] trailing modifiers
2996ok 313 # SKIP [re_tests:313] trailing modifiers
2997ok 314 # SKIP [re_tests:314] trailing modifiers
2998ok 315 # SKIP [re_tests:315] trailing modifiers
2999ok 316 # SKIP [re_tests:316] trailing modifiers
3000ok 317 # SKIP [re_tests:317] trailing modifiers
3001ok 318 # SKIP [re_tests:318] trailing modifiers
3002ok 319 # SKIP [re_tests:319] trailing modifiers
3003ok 320 # SKIP [re_tests:320] trailing modifiers
3004ok 321 # SKIP [re_tests:321] trailing modifiers
3005ok 322 # SKIP [re_tests:322] bug or error
3006ok 323 # SKIP [re_tests:323] bug or error
3007ok 324 # SKIP [re_tests:324] trailing modifiers
3008ok 325 # SKIP [re_tests:325] bug or error
3009ok 326 # SKIP [re_tests:326] trailing modifiers
3010ok 327 # SKIP [re_tests:327] trailing modifiers
3011ok 328 # SKIP [re_tests:328] trailing modifiers
3012ok 329 # SKIP [re_tests:329] trailing modifiers
3013ok 330 # SKIP [re_tests:330] bug or error
3014ok 331 # SKIP [re_tests:331] bug or error
3015ok 332 # SKIP [re_tests:332] trailing modifiers
3016ok 333 # SKIP [re_tests:333] trailing modifiers
3017ok 334 # SKIP [re_tests:334] trailing modifiers
3018ok 335 # SKIP [re_tests:335] trailing modifiers
3019ok 336 # SKIP [re_tests:336] bug or error
3020ok 337 # SKIP [re_tests:337] trailing modifiers
3021ok 338 # SKIP [re_tests:338] trailing modifiers
3022ok 339 # SKIP [re_tests:339] trailing modifiers
3023ok 340 # SKIP [re_tests:340] trailing modifiers
3024ok 341 # SKIP [re_tests:341] trailing modifiers
3025ok 342 # SKIP [re_tests:342] trailing modifiers
3026ok 343 # SKIP [re_tests:343] trailing modifiers
3027ok 344 # SKIP [re_tests:344] trailing modifiers
3028ok 345 # SKIP [re_tests:345] trailing modifiers
3029ok 346 # SKIP [re_tests:346] trailing modifiers
3030ok 347 # SKIP [re_tests:347] bug or error
3031ok 348 # SKIP [re_tests:348] trailing modifiers
3032ok 349 # SKIP [re_tests:349] trailing modifiers
3033ok 350 # SKIP [re_tests:350] trailing modifiers
3034ok 351 # SKIP [re_tests:351] trailing modifiers
3035ok 352 # SKIP [re_tests:352] trailing modifiers
3036ok 353 # SKIP [re_tests:353] trailing modifiers
3037ok 354 # SKIP [re_tests:354] trailing modifiers
3038ok 355 # SKIP [re_tests:355] trailing modifiers
3039ok 356 # SKIP [re_tests:356] trailing modifiers
3040ok 357 # SKIP [re_tests:357] trailing modifiers
3041ok 358 # SKIP [re_tests:358] trailing modifiers
3042ok 359 # SKIP [re_tests:359] trailing modifiers
3043ok 360 # SKIP [re_tests:360] trailing modifiers
3044ok 361 # SKIP [re_tests:361] trailing modifiers
3045ok 362 # SKIP [re_tests:362] trailing modifiers
3046ok 363 # SKIP [re_tests:363] trailing modifiers
3047ok 364 # SKIP [re_tests:364] trailing modifiers
3048ok 365 # SKIP [re_tests:365] trailing modifiers
3049ok 366 # SKIP [re_tests:366] trailing modifiers
3050ok 367 # SKIP [re_tests:367] trailing modifiers
3051ok 368 # SKIP [re_tests:368] trailing modifiers
3052ok 369 # SKIP [re_tests:369] trailing modifiers
3053ok 370 # SKIP [re_tests:370] trailing modifiers
3054ok 371 # SKIP [re_tests:371] trailing modifiers
3055ok 372 # SKIP [re_tests:372] trailing modifiers
3056ok 373 # SKIP [re_tests:373] trailing modifiers
3057ok 374 # SKIP [re_tests:374] trailing modifiers
3058ok 375 # SKIP [re_tests:375] trailing modifiers
3059ok 376 # SKIP [re_tests:376] trailing modifiers
3060ok 377 # SKIP [re_tests:377] trailing modifiers
3061ok 378 # SKIP [re_tests:378] trailing modifiers
3062ok 379 # SKIP [re_tests:379] trailing modifiers
3063ok 380 # SKIP [re_tests:380] trailing modifiers
3064ok 381 # SKIP [re_tests:381] trailing modifiers
3065ok 382 # SKIP [re_tests:382] trailing modifiers
3066ok 383 # SKIP [re_tests:383] trailing modifiers
3067ok 384 # SKIP [re_tests:384] trailing modifiers
3068ok 385 # SKIP [re_tests:385] trailing modifiers
3069ok 386 # SKIP [re_tests:386] trailing modifiers
3070ok 387 # SKIP [re_tests:387] trailing modifiers
3071ok 388 # SKIP [re_tests:388] trailing modifiers
3072ok 389 # SKIP [re_tests:389] trailing modifiers
3073ok 390 # SKIP [re_tests:390] trailing modifiers
3074ok 391 # SKIP [re_tests:391] trailing modifiers
3075ok 392 # SKIP [re_tests:392] trailing modifiers
3076ok 393 # SKIP [re_tests:393] trailing modifiers
3077ok 394 # SKIP [re_tests:394] trailing modifiers
3078ok 395 # SKIP [re_tests:395] trailing modifiers
3079not ok 396 # TODO [re_tests:396] unknown reason
3080not ok 397 # TODO [re_tests:397] unknown reason
3081not ok 398 # TODO [re_tests:398] unknown reason
3082ok 408 # SKIP [re_tests:408] bug or error
3083not ok 419 # TODO [re_tests:419] unknown reason
3084not ok 422 # TODO [re_tests:422] unknown reason
3085not ok 429 # TODO [re_tests:429] unknown reason
3086not ok 432 # TODO [re_tests:432] unknown reason
3087not ok 434 # TODO [re_tests:434] unknown reason
3088not ok 435 # TODO [re_tests:435] unknown reason
3089ok 436 # SKIP [re_tests:436] bug or error
3090not ok 439 # TODO [re_tests:439] unknown reason
3091not ok 446 # TODO [re_tests:446] unknown reason
3092not ok 447 # TODO [re_tests:447] unknown reason
3093not ok 448 # TODO [re_tests:448] unknown reason
3094not ok 449 # TODO [re_tests:449] unknown reason
3095not ok 452 # TODO [re_tests:452] unknown reason
3096not ok 453 # TODO [re_tests:453] unknown reason
3097not ok 454 # TODO [re_tests:454] unknown reason
3098not ok 455 # TODO [re_tests:455] unknown reason
3099ok 458 # SKIP [re_tests:458] unknown reason
3100ok 459 # SKIP [re_tests:459] unknown reason
3101ok 460 # SKIP [re_tests:460] unknown reason
3102ok 461 # SKIP [re_tests:461] unknown reason
3103ok 462 # SKIP [re_tests:462] unknown reason
3104ok 463 # SKIP [re_tests:463] unknown reason
3105ok 464 # SKIP [re_tests:464] unknown reason
3106ok 465 # SKIP [re_tests:465] unknown reason
3107ok 466 # SKIP [re_tests:466] unknown reason
3108ok 467 # SKIP [re_tests:467] unknown reason
3109ok 468 # SKIP [re_tests:468] unknown reason
3110ok 469 # SKIP [re_tests:469] unknown reason
3111ok 470 # SKIP [re_tests:470] unknown reason
3112ok 471 # SKIP [re_tests:471] unknown reason
3113ok 472 # SKIP [re_tests:472] unknown reason
3114ok 473 # SKIP [re_tests:473] unknown reason
3115ok 474 # SKIP [re_tests:474] unknown reason
3116ok 475 # SKIP [re_tests:475] unknown reason
3117ok 476 # SKIP [re_tests:476] unknown reason
3118ok 477 # SKIP [re_tests:477] unknown reason
3119ok 478 # SKIP [re_tests:478] unknown reason
3120ok 479 # SKIP [re_tests:479] unknown reason
3121ok 480 # SKIP [re_tests:480] unknown reason
3122ok 483 # SKIP [re_tests:483]
3123ok 484 # SKIP [re_tests:484]
3124ok 487 # SKIP [re_tests:487] bug or error
3125ok 488 # SKIP [re_tests:488] bug or error
3126ok 489 # SKIP [re_tests:489] bug or error
3127ok 490 # SKIP [re_tests:490] bug or error
3128ok 491 # SKIP [re_tests:491] kills a parrot
3129ok 492 # SKIP [re_tests:492] bug or error
3130ok 493 # SKIP [re_tests:493] kills a parrot
3131not ok 495 # TODO [re_tests:495] unknown reason
3132ok 496 # SKIP [re_tests:496]
3133not ok 498 # TODO [re_tests:498] unknown reason
3134not ok 500 # TODO [re_tests:500] unknown reason
3135not ok 501 # TODO [re_tests:501] unknown reason
3136ok 502 # SKIP [re_tests:502] unknown reason
3137not ok 503 # TODO [re_tests:503] unknown reason
3138not ok 504 # TODO [re_tests:504] unknown reason
3139not ok 505 # TODO [re_tests:505] unknown reason
3140not ok 506 # TODO [re_tests:506] unknown reason
3141not ok 507 # TODO [re_tests:507] unknown reason
3142not ok 508 # TODO [re_tests:508] unknown reason
3143not ok 509 # TODO [re_tests:509] unknown reason
3144not ok 510 # TODO [re_tests:510] unknown reason
3145not ok 511 # TODO [re_tests:511] unknown reason
3146not ok 512 # TODO [re_tests:512] unknown reason
3147not ok 515 # TODO [re_tests:515] unknown reason
3148not ok 521 # TODO [re_tests:521] unknown reason
3149not ok 522 # TODO [re_tests:522] unknown reason
3150not ok 523 # TODO [re_tests:523] unknown reason
3151not ok 524 # TODO [re_tests:524] unknown reason
3152not ok 527 # TODO [re_tests:527] unknown reason
3153not ok 528 # TODO [re_tests:528] unknown reason
3154ok 531 # SKIP [re_tests:531] bug or error
3155ok 532 # SKIP [re_tests:532] bug or error
3156not ok 535 # TODO [re_tests:535] unknown reason
3157not ok 536 # TODO [re_tests:536] unknown reason
3158not ok 539 # TODO [re_tests:539] unknown reason
3159not ok 540 # TODO [re_tests:540] unknown reason
3160not ok 541 # TODO [re_tests:541] unknown reason
3161not ok 544 # TODO [re_tests:544] unknown reason
3162not ok 545 # TODO [re_tests:545] unknown reason
3163ok 556 # SKIP [re_tests:556] kills a parrot
3164ok 557 # SKIP [re_tests:557] kills a parrot
3165not ok 559 # TODO [re_tests:559] unknown reason
3166ok 563 # SKIP [re_tests:563] bug or error
3167ok 564 # SKIP [re_tests:564] bug or error
3168ok 566 # SKIP [re_tests:566] bug or error
3169ok 568 # SKIP [re_tests:568] kills a parrot
3170ok 569 # SKIP [re_tests:569] kills a parrot
3171ok 570 # SKIP [re_tests:570] kills a parrot
3172ok 571 # SKIP [re_tests:571] kills a parrot
3173ok 572 # SKIP [re_tests:572] kills a parrot
3174ok 573 # SKIP [re_tests:573] kills a parrot
3175ok 574 # SKIP [re_tests:574] kills a parrot
3176ok 575 # SKIP [re_tests:575] kills a parrot
3177ok 576 # SKIP [re_tests:576] kills a parrot
3178ok 577 # SKIP [re_tests:577] kills a parrot
3179ok 578 # SKIP [re_tests:578] kills a parrot
3180ok 579 # SKIP [re_tests:579] kills a parrot
3181ok 580 # SKIP [re_tests:580] kills a parrot
3182ok 581 # SKIP [re_tests:581] kills a parrot
3183ok 582 # SKIP [re_tests:582] kills a parrot
3184ok 583 # SKIP [re_tests:583] kills a parrot
3185ok 584 # SKIP [re_tests:584] kills a parrot
3186ok 585 # SKIP [re_tests:585] kills a parrot
3187ok 586 # SKIP [re_tests:586] kills a parrot
3188ok 587 # SKIP [re_tests:587] kills a parrot
3189ok 588 # SKIP [re_tests:588] kills a parrot
3190ok 589 # SKIP [re_tests:589] kills a parrot
3191ok 590 # SKIP [re_tests:590] kills a parrot
3192ok 591 # SKIP [re_tests:591] kills a parrot
3193ok 592 # SKIP [re_tests:592] kills a parrot
3194ok 593 # SKIP [re_tests:593] bug or error
3195ok 594 # SKIP [re_tests:594] bug or error
3196not ok 595 # TODO [re_tests:595] unknown reason
3197not ok 596 # TODO [re_tests:596] unknown reason
3198ok 597 # SKIP [re_tests:597] unknown reason
3199ok 598 # SKIP [re_tests:598] bug or error
3200ok 599 # SKIP [re_tests:599] bug or error
3201not ok 600 # TODO [re_tests:600] unknown reason
3202not ok 601 # TODO [re_tests:601] unknown reason
3203not ok 603 # TODO [re_tests:603] unknown reason
3204not ok 604 # TODO [re_tests:604] unknown reason
3205not ok 606 # TODO [re_tests:606] unknown reason
3206not ok 607 # TODO [re_tests:607] unknown reason
3207ok 609 # SKIP [re_tests:609] unknown reason
3208ok 610 # SKIP [re_tests:610] unknown reason
3209ok 611 # SKIP [re_tests:611] unknown reason
3210ok 612 # SKIP [re_tests:612] unknown reason
3211ok 613 # SKIP [re_tests:613] unknown reason
3212ok 614 # SKIP [re_tests:614] unknown reason
3213ok 615 # SKIP [re_tests:615] unknown reason
3214ok 616 # SKIP [re_tests:616] unknown reason
3215ok 617 # SKIP [re_tests:617] unknown reason
3216not ok 621 # TODO [re_tests:621] unknown reason
3217not ok 623 # TODO [re_tests:623] unknown reason
3218not ok 624 # TODO [re_tests:624] unknown reason
3219not ok 625 # TODO [re_tests:625] unknown reason
3220ok 627 # SKIP [re_tests:627] unknown reason
3221ok 628 # SKIP [re_tests:628] unknown reason
3222ok 629 # SKIP [re_tests:629] unknown reason
3223ok 630 # SKIP [re_tests:630] unknown reason
3224ok 631 # SKIP [re_tests:631] unknown reason
3225ok 632 # SKIP [re_tests:632] unknown reason
3226ok 633 # SKIP [re_tests:633] unknown reason
3227ok 634 # SKIP [re_tests:634] unknown reason
3228ok 635 # SKIP [re_tests:635] unknown reason
3229not ok 639 # TODO [re_tests:639] unknown reason
3230not ok 641 # TODO [re_tests:641] unknown reason
3231not ok 642 # TODO [re_tests:642] unknown reason
3232not ok 643 # TODO [re_tests:643] unknown reason
3233ok 645 # SKIP [re_tests:645] unknown reason
3234ok 646 # SKIP [re_tests:646] unknown reason
3235ok 647 # SKIP [re_tests:647] unknown reason
3236ok 648 # SKIP [re_tests:648] unknown reason
3237ok 649 # SKIP [re_tests:649] unknown reason
3238ok 650 # SKIP [re_tests:650] unknown reason
3239ok 651 # SKIP [re_tests:651] unknown reason
3240ok 652 # SKIP [re_tests:652] unknown reason
3241ok 653 # SKIP [re_tests:653] unknown reason
3242ok 663 # SKIP [re_tests:663] unknown reason
3243ok 664 # SKIP [re_tests:664] unknown reason
3244ok 665 # SKIP [re_tests:665] unknown reason
3245ok 666 # SKIP [re_tests:666] unknown reason
3246ok 667 # SKIP [re_tests:667] unknown reason
3247ok 668 # SKIP [re_tests:668] unknown reason
3248ok 669 # SKIP [re_tests:669] unknown reason
3249ok 670 # SKIP [re_tests:670] unknown reason
3250ok 671 # SKIP [re_tests:671] unknown reason
3251ok 681 # SKIP [re_tests:681] unknown reason
3252ok 682 # SKIP [re_tests:682] unknown reason
3253ok 683 # SKIP [re_tests:683] unknown reason
3254ok 684 # SKIP [re_tests:684] unknown reason
3255ok 685 # SKIP [re_tests:685] unknown reason
3256ok 686 # SKIP [re_tests:686] unknown reason
3257ok 687 # SKIP [re_tests:687] unknown reason
3258ok 688 # SKIP [re_tests:688] unknown reason
3259ok 689 # SKIP [re_tests:689] unknown reason
3260not ok 693 # TODO [re_tests:693] unknown reason
3261not ok 695 # TODO [re_tests:695] unknown reason
3262not ok 696 # TODO [re_tests:696] unknown reason
3263not ok 697 # TODO [re_tests:697] unknown reason
3264ok 699 # SKIP [re_tests:699] unknown reason
3265ok 700 # SKIP [re_tests:700] unknown reason
3266ok 701 # SKIP [re_tests:701] unknown reason
3267ok 702 # SKIP [re_tests:702] unknown reason
3268ok 703 # SKIP [re_tests:703] unknown reason
3269ok 704 # SKIP [re_tests:704] unknown reason
3270ok 705 # SKIP [re_tests:705] unknown reason
3271ok 706 # SKIP [re_tests:706] unknown reason
3272ok 707 # SKIP [re_tests:707] unknown reason
3273ok 717 # SKIP [re_tests:717] unknown reason
3274ok 718 # SKIP [re_tests:718] unknown reason
3275ok 719 # SKIP [re_tests:719] unknown reason
3276ok 720 # SKIP [re_tests:720] unknown reason
3277ok 721 # SKIP [re_tests:721] unknown reason
3278ok 722 # SKIP [re_tests:722] unknown reason
3279ok 723 # SKIP [re_tests:723] unknown reason
3280ok 724 # SKIP [re_tests:724] unknown reason
3281ok 725 # SKIP [re_tests:725] unknown reason
3282ok 735 # SKIP [re_tests:735] unknown reason
3283ok 736 # SKIP [re_tests:736] unknown reason
3284ok 737 # SKIP [re_tests:737] unknown reason
3285ok 738 # SKIP [re_tests:738] unknown reason
3286ok 739 # SKIP [re_tests:739] unknown reason
3287ok 740 # SKIP [re_tests:740] unknown reason
3288ok 741 # SKIP [re_tests:741] unknown reason
3289ok 742 # SKIP [re_tests:742] unknown reason
3290ok 743 # SKIP [re_tests:743] unknown reason
3291not ok 747 # TODO [re_tests:747] unknown reason
3292not ok 749 # TODO [re_tests:749] unknown reason
3293not ok 750 # TODO [re_tests:750] unknown reason
3294not ok 751 # TODO [re_tests:751] unknown reason
3295ok 753 # SKIP [re_tests:753] unknown reason
3296ok 754 # SKIP [re_tests:754] unknown reason
3297ok 755 # SKIP [re_tests:755] unknown reason
3298ok 756 # SKIP [re_tests:756] unknown reason
3299ok 757 # SKIP [re_tests:757] unknown reason
3300ok 758 # SKIP [re_tests:758] unknown reason
3301ok 759 # SKIP [re_tests:759] unknown reason
3302ok 760 # SKIP [re_tests:760] unknown reason
3303ok 761 # SKIP [re_tests:761] unknown reason
3304ok 771 # SKIP [re_tests:771] unknown reason
3305ok 772 # SKIP [re_tests:772] unknown reason
3306ok 773 # SKIP [re_tests:773] unknown reason
3307ok 774 # SKIP [re_tests:774] unknown reason
3308ok 775 # SKIP [re_tests:775] unknown reason
3309ok 776 # SKIP [re_tests:776] unknown reason
3310ok 777 # SKIP [re_tests:777] unknown reason
3311ok 778 # SKIP [re_tests:778] unknown reason
3312ok 779 # SKIP [re_tests:779] unknown reason
3313ok 789 # SKIP [re_tests:789] unknown reason
3314ok 790 # SKIP [re_tests:790] unknown reason
3315ok 791 # SKIP [re_tests:791] unknown reason
3316ok 792 # SKIP [re_tests:792] unknown reason
3317ok 793 # SKIP [re_tests:793] unknown reason
3318ok 794 # SKIP [re_tests:794] unknown reason
3319ok 795 # SKIP [re_tests:795] unknown reason
3320ok 796 # SKIP [re_tests:796] unknown reason
3321ok 797 # SKIP [re_tests:797] unknown reason
3322ok 800 # SKIP [re_tests:800]
3323not ok 801 # TODO [re_tests:801] unknown reason
3324ok 802 # SKIP [re_tests:802]
3325ok 803 # SKIP [re_tests:803]
3326ok 805 # SKIP [re_tests:805]
3327ok 806 # SKIP [re_tests:806] hangs a parrot
3328ok 807 # SKIP [re_tests:807] hangs a parrot
3329ok 808 # SKIP [re_tests:808] hangs a parrot
3330ok 809 # SKIP [re_tests:809] hangs a parrot
3331ok 810 # SKIP [re_tests:810] hangs a parrot
3332ok 811 # SKIP [re_tests:811] hangs a parrot
3333ok 812 # SKIP [re_tests:812] hangs a parrot
3334ok 813 # SKIP [re_tests:813] hangs a parrot
3335ok 814 # SKIP [re_tests:814] hangs a parrot
3336ok 815 # SKIP [re_tests:815] hangs a parrot
3337ok 816 # SKIP [re_tests:816] hangs a parrot
3338ok 817 # SKIP [re_tests:817] hangs a parrot
3339ok 818 # SKIP [re_tests:818] hangs a parrot
3340ok 819 # SKIP [re_tests:819] hangs a parrot
3341ok 820 # SKIP [re_tests:820] hangs a parrot
3342ok 821 # SKIP [re_tests:821] hangs a parrot
3343ok 822 # SKIP [re_tests:822] hangs a parrot
3344ok 823 # SKIP [re_tests:823] hangs a parrot
3345not ok 827 # TODO [re_tests:827] \d in character class
3346ok 828 # SKIP [re_tests:828]
3347ok 829 # SKIP [re_tests:829]
3348ok 830 # SKIP [re_tests:830]
3349ok 834 # SKIP [re_tests:834]
3350ok 835 # SKIP [re_tests:835]
3351ok 836 # SKIP [re_tests:836]
3352ok 838 # SKIP [re_tests:838]
3353not ok 858 # TODO [re_tests:858] unknown reason
3354ok 859 # SKIP [re_tests:859]
3355ok 862 # SKIP [re_tests:862]
3356not ok 865 # TODO [re_tests:865] unknown reason
3357not ok 866 # TODO [re_tests:866] unknown reason
3358ok 877 # SKIP [re_tests:877]
3359ok 879 # SKIP [re_tests:879] [ID 20010811.006]
3360not ok 881 # TODO [re_tests:881] unknown reason
3361ok 886 # SKIP [re_tests:886]
3362not ok 887 # TODO [re_tests:887] unknown reason
3363not ok 888 # TODO [re_tests:888] unknown reason
3364not ok 890 # TODO [re_tests:890] unknown reason
3365not ok 891 # TODO [re_tests:891] unknown reason
3366not ok 893 # TODO [re_tests:893] unknown reason
3367not ok 896 # TODO [re_tests:896] unknown reason
3368not ok 897 # TODO [re_tests:897] unknown reason
3369not ok 898 # TODO [re_tests:898] unknown reason
3370not ok 899 # TODO [re_tests:899] unknown reason
3371not ok 901 # TODO [re_tests:901] greediness/lookbehind
3372not ok 904 # TODO [re_tests:904] greediness/lookbehind
3373not ok 905 # TODO [re_tests:905] greediness/lookbehind
3374not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion
3375not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion
3376not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion
3377not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion
3378not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion
3379not ok 915 # TODO [re_tests:915] non-greedy/lookbehind
3380not ok 916 # TODO [re_tests:916] non-greedy/lookbehind
3381not ok 918 # TODO [re_tests:918] non-greedy/lookbehind
3382not ok 921 # TODO [re_tests:921] non-greedy/lookbehind
3383not ok 922 # TODO [re_tests:922] non-greedy/lookbehind
3384not ok 923 # TODO [re_tests:923] unmatched bracket
3385ok 924 # SKIP [re_tests:924]
3386ok 926 # SKIP [re_tests:926] [perl #18019]
3387not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171]
3388not ok 928 # TODO [re_tests:928] reuse captured group
3389not ok 929 # TODO [re_tests:929] reuse captured group
3390not ok 930 # TODO [re_tests:930] reuse captured group
3391not ok 931 # TODO [re_tests:931] reuse captured group
3392not ok 932 # TODO [re_tests:932] reuse captured group
3393not ok 933 # TODO [re_tests:933] reuse captured group
3394not ok 934 # TODO [re_tests:934] reuse captured group
3395not ok 935 # TODO [re_tests:935] reuse captured group
3396not ok 936 # TODO [re_tests:936] reuse captured group
3397not ok 937 # TODO [re_tests:937] reuse captured group
3398not ok 938 # TODO [re_tests:938] reuse captured group
3399not ok 939 # TODO [re_tests:939] reuse captured group
3400not ok 940 # TODO [re_tests:940] reuse captured group
3401not ok 941 # TODO [re_tests:941] reuse captured group
3402not ok 942 # TODO [re_tests:942] reuse captured group
3403ok 944 # SKIP [re_tests:944] unknown reason
3404ok 945 # SKIP [re_tests:945] unknown reason
3405ok 957 # SKIP [re_tests:957]
3406ok 958 # SKIP [re_tests:958]
3407not ok 959 # TODO [re_tests:959] [perl #34195]
3408not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion
3409ok
3410t/compilers/pge/perl6regex/01-regex....
3411not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&|) - parse error
3412not ok 99 # TODO [rx_metachars:114] null pattern invalid
3413not ok 386 # TODO [rx_backtrack:4] basic
3414not ok 427 # TODO [rx_charclass:26] illegal character range
3415not ok 458 # TODO [rx_charclass:62] literal match (\")
3416not ok 459 # TODO [rx_charclass:64] literal match (\")
3417not ok 460 # TODO [rx_charclass:66] literal match with quote
3418not ok 461 # TODO [rx_charclass:68] literal match with quote
3419not ok 462 # TODO [rx_charclass:70] literal match with backslash
3420not ok 463 # TODO [rx_charclass:72] literal match with interpolation
3421not ok 464 # TODO [rx_charclass:74] literal match with interpolation
3422not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i)
3423not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s)
3424not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s)
3425not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s)
3426not ok 709 # TODO [rx_modifiers:131] basic ws match
3427not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5)
3428not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth)
3429not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth)
3430ok
3431t/compilers/pge/perl6regex/context.....
3432not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented
3433ok
3434t/compilers/tge/basic..................ok
3435t/compilers/tge/grammar................
3436not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug
3437ok
3438t/compilers/tge/parser.................ok
3439t/library/cgi_query_hash...............ok
3440t/library/coroutine....................ok
3441t/library/dumper.......................ok
3442t/library/getopt_obj...................ok
3443t/library/hllmacros....................ok
3444t/library/iter.........................ok
3445t/library/md5..........................ok
3446t/library/mime_base64..................ok
3447t/library/mt19937ar....................ok
3448t/library/p6object.....................
3449not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) >
3450ok
3451t/library/parrotlib....................ok
3452t/library/pcre.........................
3453ok 1 # SKIP no pcre-config
3454ok
3455t/library/pg...........................
3456ok 1 # SKIP skipped
3457ok 2 # SKIP skipped
3458ok 3 # SKIP skipped
3459ok 4 # SKIP skipped
3460ok 5 # SKIP skipped
3461ok 6 # SKIP skipped
3462ok 7 # SKIP skipped
3463ok 8 # SKIP skipped
3464ok 9 # SKIP skipped
3465ok 10 # SKIP skipped
3466ok 11 # SKIP skipped
3467ok 12 # SKIP skipped
3468ok 13 # SKIP skipped
3469ok 14 # SKIP skipped
3470ok 15 # SKIP skipped
3471ok 16 # SKIP skipped
3472ok 17 # SKIP skipped
3473ok 18 # SKIP skipped
3474ok 19 # SKIP skipped
3475ok 20 # SKIP skipped
3476ok 21 # SKIP skipped
3477ok 22 # SKIP skipped
3478ok 23 # SKIP skipped
3479ok 24 # SKIP skipped
3480ok 25 # SKIP skipped
3481ok 26 # SKIP skipped
3482ok 27 # SKIP skipped
3483ok 28 # SKIP skipped
3484ok 29 # SKIP skipped
3485ok 30 # SKIP skipped
3486ok 31 # SKIP skipped
3487ok 32 # SKIP skipped
3488ok 33 # SKIP skipped
3489ok 34 # SKIP skipped
3490ok 35 # SKIP skipped
3491ok 36 # SKIP skipped
3492ok 37 # SKIP skipped
3493ok 38 # SKIP skipped
3494ok 39 # SKIP skipped
3495ok 40 # SKIP skipped
3496ok 41 # SKIP skipped
3497ok 42 # SKIP skipped
3498ok 43 # SKIP skipped
3499ok
3500t/library/protoobject..................ok
3501t/library/rand.........................ok
3502t/library/range........................ok
3503t/library/streams......................
3504ok 18 # SKIP broken method invocation
3505ok 20 # SKIP broken method invocation
3506ok
3507t/library/string_utils.................ok
3508t/library/tcl_glob.....................ok
3509t/library/tcl_lib......................ok
3510t/library/test_builder_tester..........ok
3511t/library/test_class...................ok
3512t/library/test_more....................ok
3513t/library/uuid.........................ok
3514t/library/yaml_dumper..................
3515not ok 7 - properties # TODO not yet implemented
3516not ok 8 - indent string # TODO not supported
3517not ok 9 - back-referencing properties # TODO not yet implemented
3518not ok 10 - self-referential properties (1) # TODO not yet implemented
3519not ok 11 - self-referential properties (2) # TODO not yet implemented
3520not ok 26 - custom dumper # TODO not yet implemented
3521ok
3522t/library/yaml_parser_syck.............
3523not ok 1 - basic parsing # TODO Not properly implemented yet
3524ok
3525All tests successful.
3526Files=252, Tests=8326, 418 wallclock secs ( 5.94 usr  4.03 sys + 184.52 cusr 111.58 csys = 306.07 CPU)
3527Result: PASS
3528perl t/harness --gc-debug --running-make-test -g --runcore-tests
3529t/compilers/imcc/imcpasm/cfg...........ok
3530t/compilers/imcc/imcpasm/opt0..........
3531ok 1 # SKIP disabled graph coloring register allocator, RT #57028
3532ok 3 # SKIP disabled graph coloring register allocator, RT #57028
3533ok
3534t/compilers/imcc/imcpasm/opt1..........
3535ok 76 # SKIP constant concat N/Y
3536ok
3537t/compilers/imcc/imcpasm/opt2..........
3538ok 5 # SKIP loop opt disabled for now
3539ok
3540t/compilers/imcc/imcpasm/optc..........
3541not ok 9 - tailcall 1 # TODO RT #57028
3542ok
3543t/compilers/imcc/imcpasm/pcc...........ok
3544t/compilers/imcc/imcpasm/sub...........ok
3545t/compilers/imcc/reg/alloc.............ok
3546t/compilers/imcc/reg/spill.............ok
3547t/compilers/imcc/syn/bsr...............ok
3548t/compilers/imcc/syn/clash.............
3549not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet
3550ok
3551t/compilers/imcc/syn/const.............ok
3552t/compilers/imcc/syn/errors............ok
3553t/compilers/imcc/syn/eval..............
3554ok 1 # SKIP changed eval semantics - see t/pmc/eval.t
3555ok 2 # SKIP changed eval semantics - see t/pmc/eval.t
3556ok 3 # SKIP changed eval semantics - see t/pmc/eval.t
3557ok 4 # SKIP changed eval semantics - see t/pmc/eval.t
3558ok 5 # SKIP changed eval semantics - see t/pmc/eval.t
3559ok 6 # SKIP changed eval semantics - see t/pmc/eval.t
3560ok 7 # SKIP changed eval semantics - see t/pmc/eval.t
3561ok
3562t/compilers/imcc/syn/file..............
3563ok 13 # SKIP multiple loading not speced - failing
3564ok
3565t/compilers/imcc/syn/hll...............ok
3566t/compilers/imcc/syn/keyed.............
3567ok 1 # SKIP experimental
3568ok
3569t/compilers/imcc/syn/labels............ok
3570t/compilers/imcc/syn/macro.............
3571not ok 25 - unterminated macro 2 # TODO Darwin segfault -- RT #60926
3572ok
3573t/compilers/imcc/syn/objects...........ok
3574t/compilers/imcc/syn/op................ok
3575t/compilers/imcc/syn/pasm..............ok
3576t/compilers/imcc/syn/pcc...............ok
3577t/compilers/imcc/syn/pod...............
3578ok 4 # SKIP Closing out of pod from included files
3579ok
3580t/compilers/imcc/syn/regressions.......
3581not ok 4 - comments between .param(RT \#46499) # TODO broken
3582not ok 6 - whitespace between .param(RT \#46499) # TODO broken
3583not ok 7 - off by one error message (RT \#40204) # TODO broken
3584ok
3585t/compilers/imcc/syn/scope.............ok
3586t/compilers/imcc/syn/subflags..........
3587not ok 15 # TODO :method sub not found in namespace
3588ok
3589t/compilers/imcc/syn/symbols...........ok
3590t/compilers/imcc/syn/tail..............ok
3591t/compilers/imcc/syn/veracity..........ok
3592t/op/00ff-dos..........................ok
3593t/op/00ff-unix.........................ok
3594t/op/01-parse_ops......................ok
3595t/op/64bit.............................
35961..0 # Skip 64bit INTVAL platforms only
3597skipped: 64bit INTVAL platforms only
3598t/op/annotate..........................ok
3599t/op/arithmetics.......................
3600ok 28 # SKIP No integer overflow for 32-bit INTVALs without GMP installed
3601ok
3602t/op/basic.............................ok
3603t/op/bitwise...........................
3604ok 27 # SKIP no BigInt lib found
3605ok
3606t/op/box...............................ok
3607t/op/calling...........................
3608not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all
3609not ok 93 - arg mismatch with no params # TODO RT #39844
3610ok
3611t/op/cc_params.........................ok
3612t/op/cc_state..........................
3613not ok 6 - positional found, named expected # TODO cc processor state missing
3614not ok 8 - G2: argument underflow: required slurpy param # TODO failing
3615ok
3616t/op/cmp-nonbranch.....................ok
3617t/op/comp..............................ok
3618t/op/copy..............................ok
3619t/op/debuginfo.........................
3620ok 1 # SKIP disabled on fast-core
3621ok 7 # SKIP disabled on this core
3622ok 8 # SKIP disabled on this core
3623ok
3624t/op/exceptions........................
3625not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans
3626ok
3627t/op/gc................................ok
3628t/op/globals...........................ok
3629t/op/hacks.............................
3630ok 1 # SKIP no universal SIGFPE handling
3631ok 2 # SKIP no universal SIGFPE handling
3632ok
3633t/op/ifunless..........................ok
3634t/op/integer...........................ok
3635t/op/interp............................
3636ok 1 # SKIP we really shouldn't run just a label - use a sub
3637ok
3638t/op/io................................ok
3639t/op/jit...............................ok
3640t/op/jitn..............................ok
3641t/op/lexicals..........................
3642not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented
3643ok
3644t/op/literal...........................ok
3645t/op/load_bytecode.....................ok
3646t/op/number............................ok
3647t/op/pushaction........................
3648not ok 7 - pushaction: error while handling error # TODO runloop shenanigans
3649ok
3650t/op/say...............................ok
3651t/op/spawnw............................ok
3652t/op/sprintf...........................
3653ok 5 # SKIP parrot extension (%B)
3654ok 7 # SKIP perl5-specific extension (%D)
3655ok 9 # SKIP perl5-specific extension (%F)
3656ok 16 # SKIP parrot extension (%H)
3657ok 20 # SKIP parrot extension (%L)
3658ok 23 # SKIP perl5-specific extension (%O)
3659ok 24 # SKIP parrot extension (%P)
3660ok 27 # SKIP parrot extension (%S)
3661ok 29 # SKIP perl5-specific extension (%U)
3662not ok 64 # TODO [%03.2d]  actual: > 01<
3663ok 71 # SKIP perl5-specific extension (%v...)
3664ok 72 # SKIP perl5-specific extension (%v...)
3665ok 73 # SKIP perl5-specific extension (%v...)
3666ok 74 # SKIP perl5-specific extension (%v...)
3667ok 75 # SKIP perl5-specific extension (%v...)
3668ok 76 # SKIP perl5-specific extension (%v...)
3669ok 77 # SKIP perl5-specific extension (%v...)
3670ok 78 # SKIP perl5-specific extension (%v...)
3671ok 79 # SKIP perl5-specific extension (%v...)
3672ok 80 # SKIP perl5-specific extension (%v...)
3673ok 81 # SKIP perl5-specific extension (%v...)
3674ok 82 # SKIP perl5-specific extension (%v...)
3675ok 83 # SKIP perl5-specific extension (%v...)
3676ok 84 # SKIP perl5-specific extension (%v...)
3677ok 85 # SKIP perl5-specific extension (%v...)
3678ok 86 # SKIP perl5-specific extension (%v...)
3679ok 87 # SKIP perl5-specific extension (%v...)
3680ok 88 # SKIP perl5-specific extension (%v...)
3681ok 89 # SKIP perl5-specific extension (%v...)
3682ok 90 # SKIP perl5-specific extension (%v...)
3683ok 91 # SKIP perl5-specific extension (%v...)
3684ok 92 # SKIP perl5-specific extension (%v...)
3685ok 93 # SKIP perl5-specific extension (%v...)
3686ok 94 # SKIP perl5-specific extension (%v...)
3687ok 95 # SKIP perl5-specific extension (%v...)
3688ok 96 # SKIP perl5-specific extension (%v...)
3689ok 97 # SKIP perl5-specific extension (%v...)
3690ok 98 # SKIP perl5-specific extension (%v...)
3691ok 99 # SKIP perl5-specific extension (%v...)
3692ok 114 # SKIP harness needs support for * modifier
3693ok 131 # SKIP harness needs support for * modifier
3694ok 141 # SKIP harness needs support for * modifier
3695ok 144 # SKIP perl5 expresssion as test value
3696not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1<
3697ok 161 # SKIP harness needs support for * modifier
3698ok 166 # SKIP harness needs support for * modifier
3699not ok 187 # TODO [%h]  actual: ><
3700not ok 191 # TODO [%l]  actual: ><
3701ok 193 # SKIP perl5-specific test
3702ok 200 # SKIP perl5-specific test
3703ok 201 # SKIP perl5-specific test
3704ok 202 # SKIP parrot extension (%p)
3705ok 204 # SKIP parrot extension (%r)
3706ok 210 # SKIP harness needs support for * modifier
3707ok 214 # SKIP harness needs support for * modifier
3708not ok 223 # TODO [%v]  actual: ><
3709ok 233 # SKIP harness needs support for * modifier
3710ok 234 # SKIP perl5-specific extension (%v...)
3711ok 235 # SKIP perl5-specific extension (%v...)
3712ok 238 # SKIP perl5-specific test
3713ok 239 # SKIP perl5-specific test
3714ok 240 # SKIP perl5-specific test
3715ok 241 # SKIP perl5-specific test
3716ok 242 # SKIP perl5-specific test
3717ok 243 # SKIP perl5-specific test
3718ok 244 # SKIP perl5-specific test
3719ok 245 # SKIP perl5-specific test
3720ok 246 # SKIP perl5-specific test
3721ok 247 # SKIP perl5-specific test
3722ok 248 # SKIP perl5-specific test
3723ok 249 # SKIP perl5-specific test
3724ok 250 # SKIP perl5-specific test
3725ok 251 # SKIP perl5-specific test
3726ok 252 # SKIP perl5-specific extension (%v...)
3727ok 253 # SKIP perl5-specific extension (%v...)
3728ok 254 # SKIP perl5-specific extension (%v...)
3729ok 255 # SKIP perl5-specific extension (%v...)
3730ok 256 # SKIP perl5-specific extension (%v...)
3731ok 257 # SKIP perl5-specific extension (%v...)
3732ok 258 # SKIP perl5-specific extension (%v...)
3733ok 259 # SKIP perl5-specific extension (%v...)
3734ok 260 # SKIP perl5-specific extension (%v...)
3735ok 261 # SKIP perl5-specific extension (%v...)
3736ok 262 # SKIP perl5-specific extension (%v...)
3737ok 263 # SKIP perl5-specific extension (%v...)
3738ok 264 # SKIP perl5-specific extension (%v...)
3739ok 265 # SKIP perl5-specific extension (%v...)
3740ok 266 # SKIP perl5-specific extension (%v...)
3741ok 267 # SKIP perl5-specific extension (%v...)
3742ok 268 # SKIP perl5-specific extension (%v...)
3743ok 269 # SKIP perl5-specific extension (%v...)
3744ok 270 # SKIP perl5-specific extension (%v...)
3745ok 271 # SKIP perl5-specific extension (%v...)
3746ok 272 # SKIP perl5-specific extension (%v...)
3747ok 273 # SKIP perl5-specific extension (%v...)
3748ok 274 # SKIP perl5-specific extension (%v...)
3749ok 275 # SKIP perl5-specific extension (%v...)
3750ok 276 # SKIP perl5-specific extension (%v...)
3751ok 277 # SKIP perl5-specific extension (%v...)
3752ok 278 # SKIP perl5-specific extension (%v...)
3753ok 279 # SKIP perl5-specific extension (%v...)
3754ok 280 # SKIP perl5-specific extension (%v...)
3755ok 281 # SKIP perl5-specific extension (%v...)
3756ok 282 # SKIP perl5-specific extension (%v...)
3757ok 283 # SKIP perl5-specific extension (%v...)
3758ok 284 # SKIP perl5-specific extension (%v...)
3759ok 285 # SKIP perl5-specific extension (%v...)
3760ok 286 # SKIP perl5-specific extension (%v...)
3761ok 287 # SKIP perl5-specific extension (%v...)
3762ok 288 # SKIP perl5-specific extension (%v...)
3763ok 289 # SKIP perl5-specific extension (%v...)
3764ok 290 # SKIP perl5-specific extension (%v...)
3765ok 291 # SKIP perl5-specific extension (%v...)
3766ok 292 # SKIP perl5-specific extension (%v...)
3767ok 293 # SKIP perl5-specific extension (%v...)
3768ok 294 # SKIP perl5-specific extension (%v...)
3769ok 295 # SKIP perl5-specific extension (%v...)
3770ok 296 # SKIP perl5-specific extension (%v...)
3771ok 297 # SKIP perl5-specific extension (%v...)
3772ok 298 # SKIP perl5-specific extension (%v...)
3773ok 300 # SKIP harness needs support for * modifier
3774not ok 304 # TODO [%#b]  actual: >0b0<
3775not ok 305 # TODO [%#o]  actual: >00<
3776not ok 306 # TODO [%#x]  actual: >0x0<
3777ok 307 # SKIP perl5-specific extension (%v...)
3778ok 308 # SKIP perl5-specific extension (%v...)
3779ok
3780t/op/sprintf2..........................ok
3781t/op/string............................
3782ok 103 # SKIP Pending rework of creating non-ascii literals
3783ok 104 # SKIP Pending rework of creating non-ascii literals
3784ok 118 # SKIP Pending reimplementation of find_encoding
3785ok 119 # SKIP no more visible encoding
3786ok 137 # SKIP No unicode yet
3787ok 139 # SKIP no more transcode
3788ok 140 # SKIP no more chartype
3789ok
3790t/op/string_cclass.....................
3791ok 7 # SKIP unicode support unavailable
3792ok 8 # SKIP unicode support unavailable
3793ok 9 # SKIP unicode support unavailable
3794ok
3795t/op/string_cs.........................
3796ok 31 # SKIP no ICU lib
3797ok 32 # SKIP no ICU lib
3798ok 33 # SKIP no ICU lib
3799ok 34 # SKIP no ICU lib
3800ok 35 # SKIP no ICU lib
3801ok 36 # SKIP no ICU lib
3802ok 37 # SKIP no ICU lib
3803ok 38 # SKIP no ICU lib
3804ok 39 # SKIP no ICU lib
3805ok 40 # SKIP no ICU lib
3806ok 41 # SKIP no ICU lib
3807ok 42 # SKIP no ICU lib
3808ok 43 # SKIP no ICU lib
3809ok 44 # SKIP no ICU lib
3810ok 45 # SKIP no ICU lib
3811ok 46 # SKIP no ICU lib
3812ok
3813t/op/string_mem........................ok
3814t/op/stringu...........................
3815ok 20 # SKIP no ICU lib
3816ok 21 # SKIP no ICU lib
3817ok 22 # SKIP no ICU lib
3818ok 25 # SKIP Tests seem to fail on big endian machines with icu
3819ok 26 # SKIP Tests seem to fail on big endian machines with icu
3820not ok 27 - UTF-8 and Unicode literals # TODO TT #24
3821ok
3822t/op/sysinfo...........................
3823not ok 11 - sysinfo OS version string # TODO Not Currently Implemented
3824not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented
3825ok 13 # SKIP Requires a lot of work to find out the correct answer
3826ok 14 # SKIP Testing only in some known platforms
3827ok
3828t/op/time..............................ok
3829t/op/trans.............................ok
3830t/pmc/addrregistry.....................ok
3831t/pmc/array............................
3832not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken
3833ok
3834t/pmc/bigint...........................
38351..0 # Skip No BigInt Lib configured
3836skipped: No BigInt Lib configured
3837t/pmc/bignum...........................
38381..0 # Skip No BigNum PMC enabled
3839skipped: No BigNum PMC enabled
3840t/pmc/boolean..........................ok
3841t/pmc/bound_nci........................ok
3842t/pmc/callsignature....................ok
3843t/pmc/capture..........................ok
3844t/pmc/class............................
3845not ok 28 # TODO add_method() invoking method added to class works
3846ok
3847t/pmc/codestring.......................ok
3848t/pmc/complex..........................
3849ok 58 # SKIP div by zero not caught
3850ok 59 # SKIP div by zero not caught
3851ok 60 # SKIP div by zero not caught
3852ok 86 # SKIP instantiate n/y
3853ok 87 # SKIP instantiate n/y
3854ok 88 # SKIP instantiate n/y
3855ok 89 # SKIP instantiate n/y
3856ok 126 # SKIP inf is not platform-independent
3857ok 465 # SKIP add using subclass of Complex - RT #59630
3858ok 466 # SKIP add using subclass of Complex - RT #59630
3859ok 467 # SKIP add using subclass of Complex - RT #59630
3860ok
3861t/pmc/config...........................ok
3862t/pmc/continuation.....................ok
3863t/pmc/coroutine........................
3864not ok 9 - Call an exited coroutine # TODO goes one iteration too far.
3865ok
3866t/pmc/cpointer.........................ok
3867t/pmc/default..........................
3868not ok 1 - new # TODO not implemeted
3869ok
3870t/pmc/env..............................ok
3871t/pmc/eval.............................ok
3872t/pmc/eventhandler.....................ok
3873t/pmc/exception........................
3874not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans
3875not ok 25 - pushaction: error while handling error # TODO runloop shenanigans
3876not ok 27 - invoke handler in calling sub # TODO deprecate rethrow
3877not ok 30 - catch ex from C-level MULTI function # TODO broken
3878ok
3879t/pmc/exceptionhandler.................ok
3880t/pmc/exporter.........................ok
3881t/pmc/file.............................ok
3882t/pmc/filehandle.......................
3883ok 3 # SKIP no asynch calls yet
3884not ok 8 - record_separator # TODO not yet implemented
3885ok
3886t/pmc/fixedbooleanarray................ok
3887t/pmc/fixedfloatarray..................ok
3888t/pmc/fixedintegerarray................ok
3889t/pmc/fixedpmcarray....................ok
3890t/pmc/fixedstringarray.................ok
3891t/pmc/float............................ok
3892t/pmc/freeze...........................ok
3893t/pmc/globals..........................ok
3894t/pmc/hash.............................ok
3895t/pmc/integer..........................ok
3896t/pmc/io...............................
3897not ok 1 - IO on some invalid types # TODO IO on some invalid types
3898ok 8 # SKIP clone not finished yet
3899not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433
3900not ok 40 - string read/write handle # TODO no stringhandle yet
3901ok
3902t/pmc/io_iterator......................
3903not ok 1 - new # TODO not yet implemented
3904not ok 2 - shift # TODO not yet implemented
3905not ok 3 - get_bool (vtable) # TODO not yet implemented
3906ok
3907t/pmc/io_status........................
3908not ok 1 - new # TODO not yet implemented
3909not ok 2 - get_integer (vtable) # TODO not yet implemented
3910not ok 3 - get_bool (vtable) # TODO not yet implemented
3911not ok 4 - return # TODO not yet implemented
3912not ok 5 - error # TODO not yet implemented
3913not ok 6 - throw # TODO not yet implemented
3914ok
3915t/pmc/iterator.........................
3916ok 13 # SKIP N/Y: length of rest of array
3917not ok 16 - adding keys during iteration # TODO adding keys during iteration
3918not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points'
3919ok
3920t/pmc/key..............................
3921not ok 10 # TODO register and non-register string keys should be COW (RT #60128)
3922ok
3923t/pmc/lexinfo..........................ok
3924t/pmc/lexpad...........................ok
3925t/pmc/managedstruct....................ok
3926t/pmc/multidispatch....................
3927not ok 22 - MMD on PMC types - Any # TODO RT #41374
3928not ok 25 - add as method - inherited # TODO RT #41374
3929not ok 32 - use a core func for an object # TODO RT #59628
3930ok
3931t/pmc/multisub.........................ok
3932t/pmc/namespace........................
3933not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17
3934ok
3935t/pmc/nci..............................ok
3936t/pmc/null.............................ok
3937t/pmc/object-meths.....................
3938ok 14 # SKIP currently broken
3939ok 25 # SKIP no bound NCI method
3940ok
3941t/pmc/object-mro.......................ok
3942t/pmc/object...........................ok
3943t/pmc/objects..........................ok
3944t/pmc/orderedhash......................ok
3945t/pmc/os...............................ok
3946t/pmc/packfile.........................ok
3947t/pmc/packfileconstanttable............
3948not ok 3 - get_type, get_*_keyed_int # TODO See TT #385.
3949ok
3950t/pmc/packfiledirectory................ok
3951t/pmc/packfilefixupentry...............ok
3952t/pmc/packfilefixuptable...............ok
3953t/pmc/packfilerawsegment...............ok
3954t/pmc/packfilesegment..................ok
3955t/pmc/parrotclass......................ok
3956t/pmc/parrotinterpreter................ok
3957t/pmc/parrotio.........................
3958not ok 2 - open and close - synchronous # TODO not yet implemented
3959ok 3 # SKIP no asynch calls yet
3960not ok 4 - print, read, and readline - synchronous # TODO not yet implemented
3961not ok 5 - record_separator # TODO not yet implemented
3962not ok 6 - buffer_type # TODO not yet implemented
3963ok
3964t/pmc/parrotlibrary....................ok
3965t/pmc/parrotobject.....................ok
3966t/pmc/parrotrunningthread..............ok
3967t/pmc/parrotthread.....................ok
3968t/pmc/pccmethod_test...................ok
3969t/pmc/pmc..............................ok
3970t/pmc/pmcproxy.........................ok
3971t/pmc/pointer..........................ok
3972t/pmc/prop.............................ok
3973t/pmc/random...........................ok
3974t/pmc/ref..............................ok
3975t/pmc/resizablebooleanarray............ok
3976t/pmc/resizablefloatarray..............ok
3977t/pmc/resizableintegerarray............ok
3978t/pmc/resizablepmcarray................ok
3979t/pmc/resizablestringarray.............ok
3980t/pmc/retcontinuation..................ok
3981t/pmc/ro...............................
3982not ok 8 - ResizablePMCArray -- Recursive # TODO 1
3983ok
3984t/pmc/role.............................ok
3985t/pmc/scalar...........................
3986ok 1 # SKIP doesn't work yet
3987ok
3988t/pmc/scheduler........................ok
3989t/pmc/schedulermessage.................ok
3990t/pmc/sharedref........................ok
3991t/pmc/signal...........................
39921..0 # Skip Signals currently disabled
3993skipped: Signals currently disabled
3994t/pmc/slice............................
3995not ok 2 - bug with slice bits # TODO parser
3996ok
3997t/pmc/string...........................ok
3998t/pmc/stringhandle.....................
3999ok 3 # SKIP no asynch calls yet
4000not ok 9 - record_separator # TODO not yet implemented
4001ok
4002t/pmc/sub..............................ok
4003t/pmc/sys..............................ok
4004t/pmc/task.............................ok
4005t/pmc/threads..........................
4006not ok 11 - CLONE_CODE | CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511
4007not ok 15 - CLONE_CODE|CLONE_GLOBALS|CLONE_HLL|CLONE_LIBRARIES # TODO RT #41373
4008ok
4009t/pmc/timer............................ok
4010t/pmc/undef............................ok
4011t/pmc/unmanagedstruct..................ok
4012t/oo/attributes........................ok
4013t/oo/composition.......................ok
4014t/oo/inheritance.......................ok
4015t/oo/isa...............................ok
4016t/oo/metamodel.........................
4017not ok 6 # TODO tail attribute has a type
4018not ok 12 # TODO new opcode makes working objects
4019ok
4020t/oo/methods...........................ok
4021t/oo/mro-c3............................ok
4022t/oo/names.............................ok
4023t/oo/new...............................ok
4024t/oo/ops...............................ok
4025t/oo/proxy.............................ok
4026t/oo/subclass..........................ok
4027t/oo/vtableoverride....................ok
4028t/native_pbc/header....................
40291..0 # Skip pending robust testing strategy, TT #357
4030skipped: pending robust testing strategy, TT #357
4031t/native_pbc/integer...................
40321..0 # Skip pending robust testing strategy, TT #357
4033skipped: pending robust testing strategy, TT #357
4034t/native_pbc/number....................
40351..0 # Skip pending robust testing strategy, TT #357
4036skipped: pending robust testing strategy, TT #357
4037t/native_pbc/string....................
40381..0 # Skip pending robust testing strategy, TT #357
4039skipped: pending robust testing strategy, TT #357
4040t/dynpmc/dynlexpad.....................
4041not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads
4042ok
4043t/dynpmc/foo...........................
4044ok 6 # SKIP No BigInt Lib configured
4045ok
4046t/dynpmc/gdbmhash......................
40471..0 # Skip No gdbm library available
4048skipped: No gdbm library available
4049t/dynpmc/md2...........................ok
4050t/dynpmc/md4...........................ok
4051t/dynpmc/md5...........................ok
4052t/dynpmc/pair..........................ok
4053t/dynpmc/rational......................ok
4054t/dynpmc/ripemd160.....................ok
4055t/dynpmc/rotest........................ok
4056t/dynpmc/sha...........................ok
4057t/dynpmc/sha1..........................ok
4058t/dynpmc/sha256........................
40591..0 # Skip Too old library
4060skipped: Too old library
4061t/dynpmc/sha512........................
40621..0 # Skip Too old library
4063skipped: Too old library
4064t/dynpmc/subclass_with_pir_method......
4065not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces
4066not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces
4067ok
4068t/dynpmc/subproxy......................ok
4069t/dynoplibs/dan........................ok
4070t/dynoplibs/myops......................
4071ok 6 # SKIP dynops weird in CGP with events
4072ok 7 # SKIP dynops weird in CGP with events
4073ok
4074t/compilers/pct/complete_workflow......ok
4075t/compilers/pct/past...................ok
4076t/compilers/pct/pct_hllcompiler........ok
4077t/compilers/pct/post...................ok
4078t/compilers/pge/00-basic...............ok
4079t/compilers/pge/02-match...............ok
4080t/compilers/pge/03-optable.............ok
4081t/compilers/pge/04-compile.............ok
4082t/compilers/pge/06-grammar.............ok
4083t/compilers/pge/pge-hs.................ok
4084t/compilers/pge/pge....................ok
4085t/compilers/pge/pge_examples...........ok
4086t/compilers/pge/pge_globs..............ok
4087t/compilers/pge/pge_text...............ok
4088t/compilers/pge/pge_util...............ok
4089t/compilers/pge/p5regex/p5rx...........
4090not ok 116 # TODO [re_tests:116] character class in enumeration
4091not ok 119 # TODO [re_tests:119] character class in enumeration
4092not ok 120 # TODO [re_tests:120] character class in enumeration
4093not ok 123 # TODO [re_tests:123] character class in enumeration
4094not ok 124 # TODO [re_tests:124] character class in enumeration
4095not ok 127 # TODO [re_tests:127] character class in enumeration
4096ok 138 # SKIP [re_tests:138] parser bug
4097ok 139 # SKIP [re_tests:139] broken col 4?
4098ok 143 # SKIP [re_tests:143] bug or error
4099ok 144 # SKIP [re_tests:144] bug or error
4100ok 148 # SKIP [re_tests:148] bug or error
4101ok 149 # SKIP [re_tests:149] bug or error
4102ok 155 # SKIP [re_tests:155] bug or error
4103ok 167 # SKIP [re_tests:167] bug or error
4104not ok 234 # TODO [re_tests:234] unknown reason
4105not ok 235 # TODO [re_tests:235] unknown reason
4106not ok 236 # TODO [re_tests:236] unknown reason
4107not ok 246 # TODO [re_tests:246] unknown reason
4108not ok 247 # TODO [re_tests:247] unknown reason
4109ok 248 # SKIP [re_tests:248] bug or error
4110ok 249 # SKIP [re_tests:249] bug or error
4111ok 252 # SKIP [re_tests:252] bug or error
4112not ok 254 # TODO [re_tests:254] unknown reason
4113not ok 256 # TODO [re_tests:256] unknown reason
4114not ok 257 # TODO [re_tests:257] unknown reason
4115ok 264 # SKIP [re_tests:264] trailing modifiers
4116ok 265 # SKIP [re_tests:265] trailing modifiers
4117ok 266 # SKIP [re_tests:266] trailing modifiers
4118ok 267 # SKIP [re_tests:267] trailing modifiers
4119ok 268 # SKIP [re_tests:268] trailing modifiers
4120ok 269 # SKIP [re_tests:269] trailing modifiers
4121ok 270 # SKIP [re_tests:270] trailing modifiers
4122ok 271 # SKIP [re_tests:271] trailing modifiers
4123ok 272 # SKIP [re_tests:272] trailing modifiers
4124ok 273 # SKIP [re_tests:273] trailing modifiers
4125ok 274 # SKIP [re_tests:274] trailing modifiers
4126ok 275 # SKIP [re_tests:275] trailing modifiers
4127ok 276 # SKIP [re_tests:276] trailing modifiers
4128ok 277 # SKIP [re_tests:277] trailing modifiers
4129ok 278 # SKIP [re_tests:278] trailing modifiers
4130ok 279 # SKIP [re_tests:279] trailing modifiers
4131ok 280 # SKIP [re_tests:280] trailing modifiers
4132ok 281 # SKIP [re_tests:281] trailing modifiers
4133ok 282 # SKIP [re_tests:282] trailing modifiers
4134ok 283 # SKIP [re_tests:283] trailing modifiers
4135ok 284 # SKIP [re_tests:284] trailing modifiers
4136ok 285 # SKIP [re_tests:285] trailing modifiers
4137ok 286 # SKIP [re_tests:286] trailing modifiers
4138ok 287 # SKIP [re_tests:287] trailing modifiers
4139ok 288 # SKIP [re_tests:288] trailing modifiers
4140ok 289 # SKIP [re_tests:289] trailing modifiers
4141ok 290 # SKIP [re_tests:290] trailing modifiers
4142ok 291 # SKIP [re_tests:291] trailing modifiers
4143ok 292 # SKIP [re_tests:292] trailing modifiers
4144ok 293 # SKIP [re_tests:293] trailing modifiers
4145ok 294 # SKIP [re_tests:294] trailing modifiers
4146ok 295 # SKIP [re_tests:295] trailing modifiers
4147ok 296 # SKIP [re_tests:296] trailing modifiers
4148ok 297 # SKIP [re_tests:297] trailing modifiers
4149ok 298 # SKIP [re_tests:298] trailing modifiers
4150ok 299 # SKIP [re_tests:299] trailing modifiers
4151ok 300 # SKIP [re_tests:300] trailing modifiers
4152ok 301 # SKIP [re_tests:301] trailing modifiers
4153ok 302 # SKIP [re_tests:302] trailing modifiers
4154ok 303 # SKIP [re_tests:303] trailing modifiers
4155ok 304 # SKIP [re_tests:304] trailing modifiers
4156ok 305 # SKIP [re_tests:305] trailing modifiers
4157ok 306 # SKIP [re_tests:306] trailing modifiers
4158ok 307 # SKIP [re_tests:307] trailing modifiers
4159ok 308 # SKIP [re_tests:308] bug or error
4160ok 309 # SKIP [re_tests:309] bug or error
4161ok 310 # SKIP [re_tests:310] bug or error
4162ok 311 # SKIP [re_tests:311] trailing modifiers
4163ok 312 # SKIP [re_tests:312] trailing modifiers
4164ok 313 # SKIP [re_tests:313] trailing modifiers
4165ok 314 # SKIP [re_tests:314] trailing modifiers
4166ok 315 # SKIP [re_tests:315] trailing modifiers
4167ok 316 # SKIP [re_tests:316] trailing modifiers
4168ok 317 # SKIP [re_tests:317] trailing modifiers
4169ok 318 # SKIP [re_tests:318] trailing modifiers
4170ok 319 # SKIP [re_tests:319] trailing modifiers
4171ok 320 # SKIP [re_tests:320] trailing modifiers
4172ok 321 # SKIP [re_tests:321] trailing modifiers
4173ok 322 # SKIP [re_tests:322] bug or error
4174ok 323 # SKIP [re_tests:323] bug or error
4175ok 324 # SKIP [re_tests:324] trailing modifiers
4176ok 325 # SKIP [re_tests:325] bug or error
4177ok 326 # SKIP [re_tests:326] trailing modifiers
4178ok 327 # SKIP [re_tests:327] trailing modifiers
4179ok 328 # SKIP [re_tests:328] trailing modifiers
4180ok 329 # SKIP [re_tests:329] trailing modifiers
4181ok 330 # SKIP [re_tests:330] bug or error
4182ok 331 # SKIP [re_tests:331] bug or error
4183ok 332 # SKIP [re_tests:332] trailing modifiers
4184ok 333 # SKIP [re_tests:333] trailing modifiers
4185ok 334 # SKIP [re_tests:334] trailing modifiers
4186ok 335 # SKIP [re_tests:335] trailing modifiers
4187ok 336 # SKIP [re_tests:336] bug or error
4188ok 337 # SKIP [re_tests:337] trailing modifiers
4189ok 338 # SKIP [re_tests:338] trailing modifiers
4190ok 339 # SKIP [re_tests:339] trailing modifiers
4191ok 340 # SKIP [re_tests:340] trailing modifiers
4192ok 341 # SKIP [re_tests:341] trailing modifiers
4193ok 342 # SKIP [re_tests:342] trailing modifiers
4194ok 343 # SKIP [re_tests:343] trailing modifiers
4195ok 344 # SKIP [re_tests:344] trailing modifiers
4196ok 345 # SKIP [re_tests:345] trailing modifiers
4197ok 346 # SKIP [re_tests:346] trailing modifiers
4198ok 347 # SKIP [re_tests:347] bug or error
4199ok 348 # SKIP [re_tests:348] trailing modifiers
4200ok 349 # SKIP [re_tests:349] trailing modifiers
4201ok 350 # SKIP [re_tests:350] trailing modifiers
4202ok 351 # SKIP [re_tests:351] trailing modifiers
4203ok 352 # SKIP [re_tests:352] trailing modifiers
4204ok 353 # SKIP [re_tests:353] trailing modifiers
4205ok 354 # SKIP [re_tests:354] trailing modifiers
4206ok 355 # SKIP [re_tests:355] trailing modifiers
4207ok 356 # SKIP [re_tests:356] trailing modifiers
4208ok 357 # SKIP [re_tests:357] trailing modifiers
4209ok 358 # SKIP [re_tests:358] trailing modifiers
4210ok 359 # SKIP [re_tests:359] trailing modifiers
4211ok 360 # SKIP [re_tests:360] trailing modifiers
4212ok 361 # SKIP [re_tests:361] trailing modifiers
4213ok 362 # SKIP [re_tests:362] trailing modifiers
4214ok 363 # SKIP [re_tests:363] trailing modifiers
4215ok 364 # SKIP [re_tests:364] trailing modifiers
4216ok 365 # SKIP [re_tests:365] trailing modifiers
4217ok 366 # SKIP [re_tests:366] trailing modifiers
4218ok 367 # SKIP [re_tests:367] trailing modifiers
4219ok 368 # SKIP [re_tests:368] trailing modifiers
4220ok 369 # SKIP [re_tests:369] trailing modifiers
4221ok 370 # SKIP [re_tests:370] trailing modifiers
4222ok 371 # SKIP [re_tests:371] trailing modifiers
4223ok 372 # SKIP [re_tests:372] trailing modifiers
4224ok 373 # SKIP [re_tests:373] trailing modifiers
4225ok 374 # SKIP [re_tests:374] trailing modifiers
4226ok 375 # SKIP [re_tests:375] trailing modifiers
4227ok 376 # SKIP [re_tests:376] trailing modifiers
4228ok 377 # SKIP [re_tests:377] trailing modifiers
4229ok 378 # SKIP [re_tests:378] trailing modifiers
4230ok 379 # SKIP [re_tests:379] trailing modifiers
4231ok 380 # SKIP [re_tests:380] trailing modifiers
4232ok 381 # SKIP [re_tests:381] trailing modifiers
4233ok 382 # SKIP [re_tests:382] trailing modifiers
4234ok 383 # SKIP [re_tests:383] trailing modifiers
4235ok 384 # SKIP [re_tests:384] trailing modifiers
4236ok 385 # SKIP [re_tests:385] trailing modifiers
4237ok 386 # SKIP [re_tests:386] trailing modifiers
4238ok 387 # SKIP [re_tests:387] trailing modifiers
4239ok 388 # SKIP [re_tests:388] trailing modifiers
4240ok 389 # SKIP [re_tests:389] trailing modifiers
4241ok 390 # SKIP [re_tests:390] trailing modifiers
4242ok 391 # SKIP [re_tests:391] trailing modifiers
4243ok 392 # SKIP [re_tests:392] trailing modifiers
4244ok 393 # SKIP [re_tests:393] trailing modifiers
4245ok 394 # SKIP [re_tests:394] trailing modifiers
4246ok 395 # SKIP [re_tests:395] trailing modifiers
4247not ok 396 # TODO [re_tests:396] unknown reason
4248not ok 397 # TODO [re_tests:397] unknown reason
4249not ok 398 # TODO [re_tests:398] unknown reason
4250ok 408 # SKIP [re_tests:408] bug or error
4251not ok 419 # TODO [re_tests:419] unknown reason
4252not ok 422 # TODO [re_tests:422] unknown reason
4253not ok 429 # TODO [re_tests:429] unknown reason
4254not ok 432 # TODO [re_tests:432] unknown reason
4255not ok 434 # TODO [re_tests:434] unknown reason
4256not ok 435 # TODO [re_tests:435] unknown reason
4257ok 436 # SKIP [re_tests:436] bug or error
4258not ok 439 # TODO [re_tests:439] unknown reason
4259not ok 446 # TODO [re_tests:446] unknown reason
4260not ok 447 # TODO [re_tests:447] unknown reason
4261not ok 448 # TODO [re_tests:448] unknown reason
4262not ok 449 # TODO [re_tests:449] unknown reason
4263not ok 452 # TODO [re_tests:452] unknown reason
4264not ok 453 # TODO [re_tests:453] unknown reason
4265not ok 454 # TODO [re_tests:454] unknown reason
4266not ok 455 # TODO [re_tests:455] unknown reason
4267ok 458 # SKIP [re_tests:458] unknown reason
4268ok 459 # SKIP [re_tests:459] unknown reason
4269ok 460 # SKIP [re_tests:460] unknown reason
4270ok 461 # SKIP [re_tests:461] unknown reason
4271ok 462 # SKIP [re_tests:462] unknown reason
4272ok 463 # SKIP [re_tests:463] unknown reason
4273ok 464 # SKIP [re_tests:464] unknown reason
4274ok 465 # SKIP [re_tests:465] unknown reason
4275ok 466 # SKIP [re_tests:466] unknown reason
4276ok 467 # SKIP [re_tests:467] unknown reason
4277ok 468 # SKIP [re_tests:468] unknown reason
4278ok 469 # SKIP [re_tests:469] unknown reason
4279ok 470 # SKIP [re_tests:470] unknown reason
4280ok 471 # SKIP [re_tests:471] unknown reason
4281ok 472 # SKIP [re_tests:472] unknown reason
4282ok 473 # SKIP [re_tests:473] unknown reason
4283ok 474 # SKIP [re_tests:474] unknown reason
4284ok 475 # SKIP [re_tests:475] unknown reason
4285ok 476 # SKIP [re_tests:476] unknown reason
4286ok 477 # SKIP [re_tests:477] unknown reason
4287ok 478 # SKIP [re_tests:478] unknown reason
4288ok 479 # SKIP [re_tests:479] unknown reason
4289ok 480 # SKIP [re_tests:480] unknown reason
4290ok 483 # SKIP [re_tests:483]
4291ok 484 # SKIP [re_tests:484]
4292ok 487 # SKIP [re_tests:487] bug or error
4293ok 488 # SKIP [re_tests:488] bug or error
4294ok 489 # SKIP [re_tests:489] bug or error
4295ok 490 # SKIP [re_tests:490] bug or error
4296ok 491 # SKIP [re_tests:491] kills a parrot
4297ok 492 # SKIP [re_tests:492] bug or error
4298ok 493 # SKIP [re_tests:493] kills a parrot
4299not ok 495 # TODO [re_tests:495] unknown reason
4300ok 496 # SKIP [re_tests:496]
4301not ok 498 # TODO [re_tests:498] unknown reason
4302not ok 500 # TODO [re_tests:500] unknown reason
4303not ok 501 # TODO [re_tests:501] unknown reason
4304ok 502 # SKIP [re_tests:502] unknown reason
4305not ok 503 # TODO [re_tests:503] unknown reason
4306not ok 504 # TODO [re_tests:504] unknown reason
4307not ok 505 # TODO [re_tests:505] unknown reason
4308not ok 506 # TODO [re_tests:506] unknown reason
4309not ok 507 # TODO [re_tests:507] unknown reason
4310not ok 508 # TODO [re_tests:508] unknown reason
4311not ok 509 # TODO [re_tests:509] unknown reason
4312not ok 510 # TODO [re_tests:510] unknown reason
4313not ok 511 # TODO [re_tests:511] unknown reason
4314not ok 512 # TODO [re_tests:512] unknown reason
4315not ok 515 # TODO [re_tests:515] unknown reason
4316not ok 521 # TODO [re_tests:521] unknown reason
4317not ok 522 # TODO [re_tests:522] unknown reason
4318not ok 523 # TODO [re_tests:523] unknown reason
4319not ok 524 # TODO [re_tests:524] unknown reason
4320not ok 527 # TODO [re_tests:527] unknown reason
4321not ok 528 # TODO [re_tests:528] unknown reason
4322ok 531 # SKIP [re_tests:531] bug or error
4323ok 532 # SKIP [re_tests:532] bug or error
4324not ok 535 # TODO [re_tests:535] unknown reason
4325not ok 536 # TODO [re_tests:536] unknown reason
4326not ok 539 # TODO [re_tests:539] unknown reason
4327not ok 540 # TODO [re_tests:540] unknown reason
4328not ok 541 # TODO [re_tests:541] unknown reason
4329not ok 544 # TODO [re_tests:544] unknown reason
4330not ok 545 # TODO [re_tests:545] unknown reason
4331ok 556 # SKIP [re_tests:556] kills a parrot
4332ok 557 # SKIP [re_tests:557] kills a parrot
4333not ok 559 # TODO [re_tests:559] unknown reason
4334ok 563 # SKIP [re_tests:563] bug or error
4335ok 564 # SKIP [re_tests:564] bug or error
4336ok 566 # SKIP [re_tests:566] bug or error
4337ok 568 # SKIP [re_tests:568] kills a parrot
4338ok 569 # SKIP [re_tests:569] kills a parrot
4339ok 570 # SKIP [re_tests:570] kills a parrot
4340ok 571 # SKIP [re_tests:571] kills a parrot
4341ok 572 # SKIP [re_tests:572] kills a parrot
4342ok 573 # SKIP [re_tests:573] kills a parrot
4343ok 574 # SKIP [re_tests:574] kills a parrot
4344ok 575 # SKIP [re_tests:575] kills a parrot
4345ok 576 # SKIP [re_tests:576] kills a parrot
4346ok 577 # SKIP [re_tests:577] kills a parrot
4347ok 578 # SKIP [re_tests:578] kills a parrot
4348ok 579 # SKIP [re_tests:579] kills a parrot
4349ok 580 # SKIP [re_tests:580] kills a parrot
4350ok 581 # SKIP [re_tests:581] kills a parrot
4351ok 582 # SKIP [re_tests:582] kills a parrot
4352ok 583 # SKIP [re_tests:583] kills a parrot
4353ok 584 # SKIP [re_tests:584] kills a parrot
4354ok 585 # SKIP [re_tests:585] kills a parrot
4355ok 586 # SKIP [re_tests:586] kills a parrot
4356ok 587 # SKIP [re_tests:587] kills a parrot
4357ok 588 # SKIP [re_tests:588] kills a parrot
4358ok 589 # SKIP [re_tests:589] kills a parrot
4359ok 590 # SKIP [re_tests:590] kills a parrot
4360ok 591 # SKIP [re_tests:591] kills a parrot
4361ok 592 # SKIP [re_tests:592] kills a parrot
4362ok 593 # SKIP [re_tests:593] bug or error
4363ok 594 # SKIP [re_tests:594] bug or error
4364not ok 595 # TODO [re_tests:595] unknown reason
4365not ok 596 # TODO [re_tests:596] unknown reason
4366ok 597 # SKIP [re_tests:597] unknown reason
4367ok 598 # SKIP [re_tests:598] bug or error
4368ok 599 # SKIP [re_tests:599] bug or error
4369not ok 600 # TODO [re_tests:600] unknown reason
4370not ok 601 # TODO [re_tests:601] unknown reason
4371not ok 603 # TODO [re_tests:603] unknown reason
4372not ok 604 # TODO [re_tests:604] unknown reason
4373not ok 606 # TODO [re_tests:606] unknown reason
4374not ok 607 # TODO [re_tests:607] unknown reason
4375ok 609 # SKIP [re_tests:609] unknown reason
4376ok 610 # SKIP [re_tests:610] unknown reason
4377ok 611 # SKIP [re_tests:611] unknown reason
4378ok 612 # SKIP [re_tests:612] unknown reason
4379ok 613 # SKIP [re_tests:613] unknown reason
4380ok 614 # SKIP [re_tests:614] unknown reason
4381ok 615 # SKIP [re_tests:615] unknown reason
4382ok 616 # SKIP [re_tests:616] unknown reason
4383ok 617 # SKIP [re_tests:617] unknown reason
4384not ok 621 # TODO [re_tests:621] unknown reason
4385not ok 623 # TODO [re_tests:623] unknown reason
4386not ok 624 # TODO [re_tests:624] unknown reason
4387not ok 625 # TODO [re_tests:625] unknown reason
4388ok 627 # SKIP [re_tests:627] unknown reason
4389ok 628 # SKIP [re_tests:628] unknown reason
4390ok 629 # SKIP [re_tests:629] unknown reason
4391ok 630 # SKIP [re_tests:630] unknown reason
4392ok 631 # SKIP [re_tests:631] unknown reason
4393ok 632 # SKIP [re_tests:632] unknown reason
4394ok 633 # SKIP [re_tests:633] unknown reason
4395ok 634 # SKIP [re_tests:634] unknown reason
4396ok 635 # SKIP [re_tests:635] unknown reason
4397not ok 639 # TODO [re_tests:639] unknown reason
4398not ok 641 # TODO [re_tests:641] unknown reason
4399not ok 642 # TODO [re_tests:642] unknown reason
4400not ok 643 # TODO [re_tests:643] unknown reason
4401ok 645 # SKIP [re_tests:645] unknown reason
4402ok 646 # SKIP [re_tests:646] unknown reason
4403ok 647 # SKIP [re_tests:647] unknown reason
4404ok 648 # SKIP [re_tests:648] unknown reason
4405ok 649 # SKIP [re_tests:649] unknown reason
4406ok 650 # SKIP [re_tests:650] unknown reason
4407ok 651 # SKIP [re_tests:651] unknown reason
4408ok 652 # SKIP [re_tests:652] unknown reason
4409ok 653 # SKIP [re_tests:653] unknown reason
4410ok 663 # SKIP [re_tests:663] unknown reason
4411ok 664 # SKIP [re_tests:664] unknown reason
4412ok 665 # SKIP [re_tests:665] unknown reason
4413ok 666 # SKIP [re_tests:666] unknown reason
4414ok 667 # SKIP [re_tests:667] unknown reason
4415ok 668 # SKIP [re_tests:668] unknown reason
4416ok 669 # SKIP [re_tests:669] unknown reason
4417ok 670 # SKIP [re_tests:670] unknown reason
4418ok 671 # SKIP [re_tests:671] unknown reason
4419ok 681 # SKIP [re_tests:681] unknown reason
4420ok 682 # SKIP [re_tests:682] unknown reason
4421ok 683 # SKIP [re_tests:683] unknown reason
4422ok 684 # SKIP [re_tests:684] unknown reason
4423ok 685 # SKIP [re_tests:685] unknown reason
4424ok 686 # SKIP [re_tests:686] unknown reason
4425ok 687 # SKIP [re_tests:687] unknown reason
4426ok 688 # SKIP [re_tests:688] unknown reason
4427ok 689 # SKIP [re_tests:689] unknown reason
4428not ok 693 # TODO [re_tests:693] unknown reason
4429not ok 695 # TODO [re_tests:695] unknown reason
4430not ok 696 # TODO [re_tests:696] unknown reason
4431not ok 697 # TODO [re_tests:697] unknown reason
4432ok 699 # SKIP [re_tests:699] unknown reason
4433ok 700 # SKIP [re_tests:700] unknown reason
4434ok 701 # SKIP [re_tests:701] unknown reason
4435ok 702 # SKIP [re_tests:702] unknown reason
4436ok 703 # SKIP [re_tests:703] unknown reason
4437ok 704 # SKIP [re_tests:704] unknown reason
4438ok 705 # SKIP [re_tests:705] unknown reason
4439ok 706 # SKIP [re_tests:706] unknown reason
4440ok 707 # SKIP [re_tests:707] unknown reason
4441ok 717 # SKIP [re_tests:717] unknown reason
4442ok 718 # SKIP [re_tests:718] unknown reason
4443ok 719 # SKIP [re_tests:719] unknown reason
4444ok 720 # SKIP [re_tests:720] unknown reason
4445ok 721 # SKIP [re_tests:721] unknown reason
4446ok 722 # SKIP [re_tests:722] unknown reason
4447ok 723 # SKIP [re_tests:723] unknown reason
4448ok 724 # SKIP [re_tests:724] unknown reason
4449ok 725 # SKIP [re_tests:725] unknown reason
4450ok 735 # SKIP [re_tests:735] unknown reason
4451ok 736 # SKIP [re_tests:736] unknown reason
4452ok 737 # SKIP [re_tests:737] unknown reason
4453ok 738 # SKIP [re_tests:738] unknown reason
4454ok 739 # SKIP [re_tests:739] unknown reason
4455ok 740 # SKIP [re_tests:740] unknown reason
4456ok 741 # SKIP [re_tests:741] unknown reason
4457ok 742 # SKIP [re_tests:742] unknown reason
4458ok 743 # SKIP [re_tests:743] unknown reason
4459not ok 747 # TODO [re_tests:747] unknown reason
4460not ok 749 # TODO [re_tests:749] unknown reason
4461not ok 750 # TODO [re_tests:750] unknown reason
4462not ok 751 # TODO [re_tests:751] unknown reason
4463ok 753 # SKIP [re_tests:753] unknown reason
4464ok 754 # SKIP [re_tests:754] unknown reason
4465ok 755 # SKIP [re_tests:755] unknown reason
4466ok 756 # SKIP [re_tests:756] unknown reason
4467ok 757 # SKIP [re_tests:757] unknown reason
4468ok 758 # SKIP [re_tests:758] unknown reason
4469ok 759 # SKIP [re_tests:759] unknown reason
4470ok 760 # SKIP [re_tests:760] unknown reason
4471ok 761 # SKIP [re_tests:761] unknown reason
4472ok 771 # SKIP [re_tests:771] unknown reason
4473ok 772 # SKIP [re_tests:772] unknown reason
4474ok 773 # SKIP [re_tests:773] unknown reason
4475ok 774 # SKIP [re_tests:774] unknown reason
4476ok 775 # SKIP [re_tests:775] unknown reason
4477ok 776 # SKIP [re_tests:776] unknown reason
4478ok 777 # SKIP [re_tests:777] unknown reason
4479ok 778 # SKIP [re_tests:778] unknown reason
4480ok 779 # SKIP [re_tests:779] unknown reason
4481ok 789 # SKIP [re_tests:789] unknown reason
4482ok 790 # SKIP [re_tests:790] unknown reason
4483ok 791 # SKIP [re_tests:791] unknown reason
4484ok 792 # SKIP [re_tests:792] unknown reason
4485ok 793 # SKIP [re_tests:793] unknown reason
4486ok 794 # SKIP [re_tests:794] unknown reason
4487ok 795 # SKIP [re_tests:795] unknown reason
4488ok 796 # SKIP [re_tests:796] unknown reason
4489ok 797 # SKIP [re_tests:797] unknown reason
4490ok 800 # SKIP [re_tests:800]
4491not ok 801 # TODO [re_tests:801] unknown reason
4492ok 802 # SKIP [re_tests:802]
4493ok 803 # SKIP [re_tests:803]
4494ok 805 # SKIP [re_tests:805]
4495ok 806 # SKIP [re_tests:806] hangs a parrot
4496ok 807 # SKIP [re_tests:807] hangs a parrot
4497ok 808 # SKIP [re_tests:808] hangs a parrot
4498ok 809 # SKIP [re_tests:809] hangs a parrot
4499ok 810 # SKIP [re_tests:810] hangs a parrot
4500ok 811 # SKIP [re_tests:811] hangs a parrot
4501ok 812 # SKIP [re_tests:812] hangs a parrot
4502ok 813 # SKIP [re_tests:813] hangs a parrot
4503ok 814 # SKIP [re_tests:814] hangs a parrot
4504ok 815 # SKIP [re_tests:815] hangs a parrot
4505ok 816 # SKIP [re_tests:816] hangs a parrot
4506ok 817 # SKIP [re_tests:817] hangs a parrot
4507ok 818 # SKIP [re_tests:818] hangs a parrot
4508ok 819 # SKIP [re_tests:819] hangs a parrot
4509ok 820 # SKIP [re_tests:820] hangs a parrot
4510ok 821 # SKIP [re_tests:821] hangs a parrot
4511ok 822 # SKIP [re_tests:822] hangs a parrot
4512ok 823 # SKIP [re_tests:823] hangs a parrot
4513not ok 827 # TODO [re_tests:827] \d in character class
4514ok 828 # SKIP [re_tests:828]
4515ok 829 # SKIP [re_tests:829]
4516ok 830 # SKIP [re_tests:830]
4517ok 834 # SKIP [re_tests:834]
4518ok 835 # SKIP [re_tests:835]
4519ok 836 # SKIP [re_tests:836]
4520ok 838 # SKIP [re_tests:838]
4521not ok 858 # TODO [re_tests:858] unknown reason
4522ok 859 # SKIP [re_tests:859]
4523ok 862 # SKIP [re_tests:862]
4524not ok 865 # TODO [re_tests:865] unknown reason
4525not ok 866 # TODO [re_tests:866] unknown reason
4526ok 877 # SKIP [re_tests:877]
4527ok 879 # SKIP [re_tests:879] [ID 20010811.006]
4528not ok 881 # TODO [re_tests:881] unknown reason
4529ok 886 # SKIP [re_tests:886]
4530not ok 887 # TODO [re_tests:887] unknown reason
4531not ok 888 # TODO [re_tests:888] unknown reason
4532not ok 890 # TODO [re_tests:890] unknown reason
4533not ok 891 # TODO [re_tests:891] unknown reason
4534not ok 893 # TODO [re_tests:893] unknown reason
4535not ok 896 # TODO [re_tests:896] unknown reason
4536not ok 897 # TODO [re_tests:897] unknown reason
4537not ok 898 # TODO [re_tests:898] unknown reason
4538not ok 899 # TODO [re_tests:899] unknown reason
4539not ok 901 # TODO [re_tests:901] greediness/lookbehind
4540not ok 904 # TODO [re_tests:904] greediness/lookbehind
4541not ok 905 # TODO [re_tests:905] greediness/lookbehind
4542not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion
4543not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion
4544not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion
4545not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion
4546not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion
4547not ok 915 # TODO [re_tests:915] non-greedy/lookbehind
4548not ok 916 # TODO [re_tests:916] non-greedy/lookbehind
4549not ok 918 # TODO [re_tests:918] non-greedy/lookbehind
4550not ok 921 # TODO [re_tests:921] non-greedy/lookbehind
4551not ok 922 # TODO [re_tests:922] non-greedy/lookbehind
4552not ok 923 # TODO [re_tests:923] unmatched bracket
4553ok 924 # SKIP [re_tests:924]
4554ok 926 # SKIP [re_tests:926] [perl #18019]
4555not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171]
4556not ok 928 # TODO [re_tests:928] reuse captured group
4557not ok 929 # TODO [re_tests:929] reuse captured group
4558not ok 930 # TODO [re_tests:930] reuse captured group
4559not ok 931 # TODO [re_tests:931] reuse captured group
4560not ok 932 # TODO [re_tests:932] reuse captured group
4561not ok 933 # TODO [re_tests:933] reuse captured group
4562not ok 934 # TODO [re_tests:934] reuse captured group
4563not ok 935 # TODO [re_tests:935] reuse captured group
4564not ok 936 # TODO [re_tests:936] reuse captured group
4565not ok 937 # TODO [re_tests:937] reuse captured group
4566not ok 938 # TODO [re_tests:938] reuse captured group
4567not ok 939 # TODO [re_tests:939] reuse captured group
4568not ok 940 # TODO [re_tests:940] reuse captured group
4569not ok 941 # TODO [re_tests:941] reuse captured group
4570not ok 942 # TODO [re_tests:942] reuse captured group
4571ok 944 # SKIP [re_tests:944] unknown reason
4572ok 945 # SKIP [re_tests:945] unknown reason
4573ok 957 # SKIP [re_tests:957]
4574ok 958 # SKIP [re_tests:958]
4575not ok 959 # TODO [re_tests:959] [perl #34195]
4576not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion
4577ok
4578t/compilers/pge/perl6regex/01-regex....
4579not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&|) - parse error
4580not ok 99 # TODO [rx_metachars:114] null pattern invalid
4581not ok 386 # TODO [rx_backtrack:4] basic
4582not ok 427 # TODO [rx_charclass:26] illegal character range
4583not ok 458 # TODO [rx_charclass:62] literal match (\")
4584not ok 459 # TODO [rx_charclass:64] literal match (\")
4585not ok 460 # TODO [rx_charclass:66] literal match with quote
4586not ok 461 # TODO [rx_charclass:68] literal match with quote
4587not ok 462 # TODO [rx_charclass:70] literal match with backslash
4588not ok 463 # TODO [rx_charclass:72] literal match with interpolation
4589not ok 464 # TODO [rx_charclass:74] literal match with interpolation
4590not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i)
4591not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s)
4592not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s)
4593not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s)
4594not ok 709 # TODO [rx_modifiers:131] basic ws match
4595not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5)
4596not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth)
4597not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth)
4598ok
4599t/compilers/pge/perl6regex/context.....
4600not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented
4601ok
4602t/compilers/tge/basic..................ok
4603t/compilers/tge/grammar................
4604not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug
4605ok
4606t/compilers/tge/parser.................ok
4607t/library/cgi_query_hash...............ok
4608t/library/coroutine....................ok
4609t/library/dumper.......................ok
4610t/library/getopt_obj...................ok
4611t/library/hllmacros....................ok
4612t/library/iter.........................ok
4613t/library/md5..........................ok
4614t/library/mime_base64..................ok
4615t/library/mt19937ar....................ok
4616t/library/p6object.....................
4617not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) >
4618ok
4619t/library/parrotlib....................ok
4620t/library/pcre.........................
4621ok 1 # SKIP no pcre-config
4622ok
4623t/library/pg...........................
4624ok 1 # SKIP skipped
4625ok 2 # SKIP skipped
4626ok 3 # SKIP skipped
4627ok 4 # SKIP skipped
4628ok 5 # SKIP skipped
4629ok 6 # SKIP skipped
4630ok 7 # SKIP skipped
4631ok 8 # SKIP skipped
4632ok 9 # SKIP skipped
4633ok 10 # SKIP skipped
4634ok 11 # SKIP skipped
4635ok 12 # SKIP skipped
4636ok 13 # SKIP skipped
4637ok 14 # SKIP skipped
4638ok 15 # SKIP skipped
4639ok 16 # SKIP skipped
4640ok 17 # SKIP skipped
4641ok 18 # SKIP skipped
4642ok 19 # SKIP skipped
4643ok 20 # SKIP skipped
4644ok 21 # SKIP skipped
4645ok 22 # SKIP skipped
4646ok 23 # SKIP skipped
4647ok 24 # SKIP skipped
4648ok 25 # SKIP skipped
4649ok 26 # SKIP skipped
4650ok 27 # SKIP skipped
4651ok 28 # SKIP skipped
4652ok 29 # SKIP skipped
4653ok 30 # SKIP skipped
4654ok 31 # SKIP skipped
4655ok 32 # SKIP skipped
4656ok 33 # SKIP skipped
4657ok 34 # SKIP skipped
4658ok 35 # SKIP skipped
4659ok 36 # SKIP skipped
4660ok 37 # SKIP skipped
4661ok 38 # SKIP skipped
4662ok 39 # SKIP skipped
4663ok 40 # SKIP skipped
4664ok 41 # SKIP skipped
4665ok 42 # SKIP skipped
4666ok 43 # SKIP skipped
4667ok
4668t/library/protoobject..................ok
4669t/library/rand.........................ok
4670t/library/range........................ok
4671t/library/streams......................
4672ok 18 # SKIP broken method invocation
4673ok 20 # SKIP broken method invocation
4674ok
4675t/library/string_utils.................ok
4676t/library/tcl_glob.....................ok
4677t/library/tcl_lib......................ok
4678t/library/test_builder_tester..........ok
4679t/library/test_class...................ok
4680t/library/test_more....................ok
4681t/library/uuid.........................ok
4682t/library/yaml_dumper..................
4683not ok 7 - properties # TODO not yet implemented
4684not ok 8 - indent string # TODO not supported
4685not ok 9 - back-referencing properties # TODO not yet implemented
4686not ok 10 - self-referential properties (1) # TODO not yet implemented
4687not ok 11 - self-referential properties (2) # TODO not yet implemented
4688not ok 26 - custom dumper # TODO not yet implemented
4689ok
4690t/library/yaml_parser_syck.............
4691not ok 1 - basic parsing # TODO Not properly implemented yet
4692ok
4693All tests successful.
4694Files=252, Tests=8326, 407 wallclock secs ( 5.99 usr  4.01 sys + 185.26 cusr 109.53 csys = 304.79 CPU)
4695Result: PASS
4696perl t/harness --gc-debug --running-make-test -j --runcore-tests
4697t/compilers/imcc/imcpasm/cfg...........ok
4698t/compilers/imcc/imcpasm/opt0..........
4699ok 1 # SKIP disabled graph coloring register allocator, RT #57028
4700ok 3 # SKIP disabled graph coloring register allocator, RT #57028
4701ok
4702t/compilers/imcc/imcpasm/opt1..........
4703ok 76 # SKIP constant concat N/Y
4704ok
4705t/compilers/imcc/imcpasm/opt2..........
4706ok 5 # SKIP loop opt disabled for now
4707ok
4708t/compilers/imcc/imcpasm/optc..........
4709not ok 9 - tailcall 1 # TODO RT #57028
4710ok
4711t/compilers/imcc/imcpasm/pcc...........ok
4712t/compilers/imcc/imcpasm/sub...........ok
4713t/compilers/imcc/reg/alloc.............ok
4714t/compilers/imcc/reg/spill.............ok
4715t/compilers/imcc/syn/bsr...............ok
4716t/compilers/imcc/syn/clash.............
4717not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet
4718ok
4719t/compilers/imcc/syn/const.............ok
4720t/compilers/imcc/syn/errors............ok
4721t/compilers/imcc/syn/eval..............
4722ok 1 # SKIP changed eval semantics - see t/pmc/eval.t
4723ok 2 # SKIP changed eval semantics - see t/pmc/eval.t
4724ok 3 # SKIP changed eval semantics - see t/pmc/eval.t
4725ok 4 # SKIP changed eval semantics - see t/pmc/eval.t
4726ok 5 # SKIP changed eval semantics - see t/pmc/eval.t
4727ok 6 # SKIP changed eval semantics - see t/pmc/eval.t
4728ok 7 # SKIP changed eval semantics - see t/pmc/eval.t
4729ok
4730t/compilers/imcc/syn/file..............
4731ok 13 # SKIP multiple loading not speced - failing
4732ok
4733t/compilers/imcc/syn/hll...............ok
4734t/compilers/imcc/syn/keyed.............
4735ok 1 # SKIP experimental
4736ok
4737t/compilers/imcc/syn/labels............ok
4738t/compilers/imcc/syn/macro.............
4739not ok 25 - unterminated macro 2 # TODO Darwin segfault -- RT #60926
4740ok
4741t/compilers/imcc/syn/objects...........ok
4742t/compilers/imcc/syn/op................ok
4743t/compilers/imcc/syn/pasm..............ok
4744t/compilers/imcc/syn/pcc...............ok
4745t/compilers/imcc/syn/pod...............
4746ok 4 # SKIP Closing out of pod from included files
4747ok
4748t/compilers/imcc/syn/regressions.......
4749not ok 4 - comments between .param(RT \#46499) # TODO broken
4750not ok 6 - whitespace between .param(RT \#46499) # TODO broken
4751not ok 7 - off by one error message (RT \#40204) # TODO broken
4752ok
4753t/compilers/imcc/syn/scope.............ok
4754t/compilers/imcc/syn/subflags..........
4755not ok 15 # TODO :method sub not found in namespace
4756ok
4757t/compilers/imcc/syn/symbols...........ok
4758t/compilers/imcc/syn/tail..............ok
4759t/compilers/imcc/syn/veracity..........ok
4760t/op/00ff-dos..........................ok
4761t/op/00ff-unix.........................ok
4762t/op/01-parse_ops......................
47631..0 # Skip IMCC cannot do parse-only with JIT enabled
4764skipped: IMCC cannot do parse-only with JIT enabled
4765t/op/64bit.............................
47661..0 # Skip 64bit INTVAL platforms only
4767skipped: 64bit INTVAL platforms only
4768t/op/annotate..........................ok
4769t/op/arithmetics.......................
4770ok 28 # SKIP No integer overflow for 32-bit INTVALs without GMP installed
4771ok
4772t/op/basic.............................ok
4773t/op/bitwise...........................
4774ok 27 # SKIP no BigInt lib found
4775ok
4776t/op/box...............................ok
4777t/op/calling...........................
4778not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all
4779not ok 93 - arg mismatch with no params # TODO RT #39844
4780ok
4781t/op/cc_params.........................ok
4782t/op/cc_state..........................
4783not ok 6 - positional found, named expected # TODO cc processor state missing
4784not ok 8 - G2: argument underflow: required slurpy param # TODO failing
4785ok
4786t/op/cmp-nonbranch.....................ok
4787t/op/comp..............................ok
4788t/op/copy..............................ok
4789t/op/debuginfo.........................
4790ok 7 # SKIP disabled on this core
4791ok 8 # SKIP disabled on this core
4792ok
4793t/op/exceptions........................
4794not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans
4795ok
4796t/op/gc................................ok
4797t/op/globals...........................ok
4798t/op/hacks.............................
4799ok 1 # SKIP no universal SIGFPE handling
4800ok 2 # SKIP no universal SIGFPE handling
4801ok
4802t/op/ifunless..........................ok
4803t/op/integer...........................ok
4804t/op/interp............................
4805ok 1 # SKIP we really shouldn't run just a label - use a sub
4806ok
4807t/op/io................................ok
4808t/op/jit...............................ok
4809t/op/jitn..............................ok
4810t/op/lexicals..........................
4811not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented
4812ok
4813t/op/literal...........................ok
4814t/op/load_bytecode.....................ok
4815t/op/number............................ok
4816t/op/pushaction........................
4817not ok 7 - pushaction: error while handling error # TODO runloop shenanigans
4818ok
4819t/op/say...............................ok
4820t/op/spawnw............................ok
4821t/op/sprintf...........................
4822ok 5 # SKIP parrot extension (%B)
4823ok 7 # SKIP perl5-specific extension (%D)
4824ok 9 # SKIP perl5-specific extension (%F)
4825ok 16 # SKIP parrot extension (%H)
4826ok 20 # SKIP parrot extension (%L)
4827ok 23 # SKIP perl5-specific extension (%O)
4828ok 24 # SKIP parrot extension (%P)
4829ok 27 # SKIP parrot extension (%S)
4830ok 29 # SKIP perl5-specific extension (%U)
4831not ok 64 # TODO [%03.2d]  actual: > 01<
4832ok 71 # SKIP perl5-specific extension (%v...)
4833ok 72 # SKIP perl5-specific extension (%v...)
4834ok 73 # SKIP perl5-specific extension (%v...)
4835ok 74 # SKIP perl5-specific extension (%v...)
4836ok 75 # SKIP perl5-specific extension (%v...)
4837ok 76 # SKIP perl5-specific extension (%v...)
4838ok 77 # SKIP perl5-specific extension (%v...)
4839ok 78 # SKIP perl5-specific extension (%v...)
4840ok 79 # SKIP perl5-specific extension (%v...)
4841ok 80 # SKIP perl5-specific extension (%v...)
4842ok 81 # SKIP perl5-specific extension (%v...)
4843ok 82 # SKIP perl5-specific extension (%v...)
4844ok 83 # SKIP perl5-specific extension (%v...)
4845ok 84 # SKIP perl5-specific extension (%v...)
4846ok 85 # SKIP perl5-specific extension (%v...)
4847ok 86 # SKIP perl5-specific extension (%v...)
4848ok 87 # SKIP perl5-specific extension (%v...)
4849ok 88 # SKIP perl5-specific extension (%v...)
4850ok 89 # SKIP perl5-specific extension (%v...)
4851ok 90 # SKIP perl5-specific extension (%v...)
4852ok 91 # SKIP perl5-specific extension (%v...)
4853ok 92 # SKIP perl5-specific extension (%v...)
4854ok 93 # SKIP perl5-specific extension (%v...)
4855ok 94 # SKIP perl5-specific extension (%v...)
4856ok 95 # SKIP perl5-specific extension (%v...)
4857ok 96 # SKIP perl5-specific extension (%v...)
4858ok 97 # SKIP perl5-specific extension (%v...)
4859ok 98 # SKIP perl5-specific extension (%v...)
4860ok 99 # SKIP perl5-specific extension (%v...)
4861ok 114 # SKIP harness needs support for * modifier
4862ok 131 # SKIP harness needs support for * modifier
4863ok 141 # SKIP harness needs support for * modifier
4864ok 144 # SKIP perl5 expresssion as test value
4865not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1<
4866ok 161 # SKIP harness needs support for * modifier
4867ok 166 # SKIP harness needs support for * modifier
4868not ok 187 # TODO [%h]  actual: ><
4869not ok 191 # TODO [%l]  actual: ><
4870ok 193 # SKIP perl5-specific test
4871ok 200 # SKIP perl5-specific test
4872ok 201 # SKIP perl5-specific test
4873ok 202 # SKIP parrot extension (%p)
4874ok 204 # SKIP parrot extension (%r)
4875ok 210 # SKIP harness needs support for * modifier
4876ok 214 # SKIP harness needs support for * modifier
4877not ok 223 # TODO [%v]  actual: ><
4878ok 233 # SKIP harness needs support for * modifier
4879ok 234 # SKIP perl5-specific extension (%v...)
4880ok 235 # SKIP perl5-specific extension (%v...)
4881ok 238 # SKIP perl5-specific test
4882ok 239 # SKIP perl5-specific test
4883ok 240 # SKIP perl5-specific test
4884ok 241 # SKIP perl5-specific test
4885ok 242 # SKIP perl5-specific test
4886ok 243 # SKIP perl5-specific test
4887ok 244 # SKIP perl5-specific test
4888ok 245 # SKIP perl5-specific test
4889ok 246 # SKIP perl5-specific test
4890ok 247 # SKIP perl5-specific test
4891ok 248 # SKIP perl5-specific test
4892ok 249 # SKIP perl5-specific test
4893ok 250 # SKIP perl5-specific test
4894ok 251 # SKIP perl5-specific test
4895ok 252 # SKIP perl5-specific extension (%v...)
4896ok 253 # SKIP perl5-specific extension (%v...)
4897ok 254 # SKIP perl5-specific extension (%v...)
4898ok 255 # SKIP perl5-specific extension (%v...)
4899ok 256 # SKIP perl5-specific extension (%v...)
4900ok 257 # SKIP perl5-specific extension (%v...)
4901ok 258 # SKIP perl5-specific extension (%v...)
4902ok 259 # SKIP perl5-specific extension (%v...)
4903ok 260 # SKIP perl5-specific extension (%v...)
4904ok 261 # SKIP perl5-specific extension (%v...)
4905ok 262 # SKIP perl5-specific extension (%v...)
4906ok 263 # SKIP perl5-specific extension (%v...)
4907ok 264 # SKIP perl5-specific extension (%v...)
4908ok 265 # SKIP perl5-specific extension (%v...)
4909ok 266 # SKIP perl5-specific extension (%v...)
4910ok 267 # SKIP perl5-specific extension (%v...)
4911ok 268 # SKIP perl5-specific extension (%v...)
4912ok 269 # SKIP perl5-specific extension (%v...)
4913ok 270 # SKIP perl5-specific extension (%v...)
4914ok 271 # SKIP perl5-specific extension (%v...)
4915ok 272 # SKIP perl5-specific extension (%v...)
4916ok 273 # SKIP perl5-specific extension (%v...)
4917ok 274 # SKIP perl5-specific extension (%v...)
4918ok 275 # SKIP perl5-specific extension (%v...)
4919ok 276 # SKIP perl5-specific extension (%v...)
4920ok 277 # SKIP perl5-specific extension (%v...)
4921ok 278 # SKIP perl5-specific extension (%v...)
4922ok 279 # SKIP perl5-specific extension (%v...)
4923ok 280 # SKIP perl5-specific extension (%v...)
4924ok 281 # SKIP perl5-specific extension (%v...)
4925ok 282 # SKIP perl5-specific extension (%v...)
4926ok 283 # SKIP perl5-specific extension (%v...)
4927ok 284 # SKIP perl5-specific extension (%v...)
4928ok 285 # SKIP perl5-specific extension (%v...)
4929ok 286 # SKIP perl5-specific extension (%v...)
4930ok 287 # SKIP perl5-specific extension (%v...)
4931ok 288 # SKIP perl5-specific extension (%v...)
4932ok 289 # SKIP perl5-specific extension (%v...)
4933ok 290 # SKIP perl5-specific extension (%v...)
4934ok 291 # SKIP perl5-specific extension (%v...)
4935ok 292 # SKIP perl5-specific extension (%v...)
4936ok 293 # SKIP perl5-specific extension (%v...)
4937ok 294 # SKIP perl5-specific extension (%v...)
4938ok 295 # SKIP perl5-specific extension (%v...)
4939ok 296 # SKIP perl5-specific extension (%v...)
4940ok 297 # SKIP perl5-specific extension (%v...)
4941ok 298 # SKIP perl5-specific extension (%v...)
4942ok 300 # SKIP harness needs support for * modifier
4943not ok 304 # TODO [%#b]  actual: >0b0<
4944not ok 305 # TODO [%#o]  actual: >00<
4945not ok 306 # TODO [%#x]  actual: >0x0<
4946ok 307 # SKIP perl5-specific extension (%v...)
4947ok 308 # SKIP perl5-specific extension (%v...)
4948ok
4949t/op/sprintf2..........................ok
4950t/op/string............................
4951ok 103 # SKIP Pending rework of creating non-ascii literals
4952ok 104 # SKIP Pending rework of creating non-ascii literals
4953ok 118 # SKIP Pending reimplementation of find_encoding
4954ok 119 # SKIP no more visible encoding
4955ok 137 # SKIP No unicode yet
4956ok 139 # SKIP no more transcode
4957ok 140 # SKIP no more chartype
4958ok
4959t/op/string_cclass.....................
4960ok 7 # SKIP unicode support unavailable
4961ok 8 # SKIP unicode support unavailable
4962ok 9 # SKIP unicode support unavailable
4963ok
4964t/op/string_cs.........................
4965ok 31 # SKIP no ICU lib
4966ok 32 # SKIP no ICU lib
4967ok 33 # SKIP no ICU lib
4968ok 34 # SKIP no ICU lib
4969ok 35 # SKIP no ICU lib
4970ok 36 # SKIP no ICU lib
4971ok 37 # SKIP no ICU lib
4972ok 38 # SKIP no ICU lib
4973ok 39 # SKIP no ICU lib
4974ok 40 # SKIP no ICU lib
4975ok 41 # SKIP no ICU lib
4976ok 42 # SKIP no ICU lib
4977ok 43 # SKIP no ICU lib
4978ok 44 # SKIP no ICU lib
4979ok 45 # SKIP no ICU lib
4980ok 46 # SKIP no ICU lib
4981ok
4982t/op/string_mem........................ok
4983t/op/stringu...........................
4984ok 20 # SKIP no ICU lib
4985ok 21 # SKIP no ICU lib
4986ok 22 # SKIP no ICU lib
4987ok 25 # SKIP Tests seem to fail on big endian machines with icu
4988ok 26 # SKIP Tests seem to fail on big endian machines with icu
4989not ok 27 - UTF-8 and Unicode literals # TODO TT #24
4990ok
4991t/op/sysinfo...........................
4992not ok 11 - sysinfo OS version string # TODO Not Currently Implemented
4993not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented
4994ok 13 # SKIP Requires a lot of work to find out the correct answer
4995ok 14 # SKIP Testing only in some known platforms
4996ok
4997t/op/time..............................ok
4998t/op/trans.............................
4999ok 13 - atan2 # TODO broken under JIT TT #201
5000ok
5001t/pmc/addrregistry.....................ok
5002t/pmc/array............................
5003not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken
5004ok
5005t/pmc/bigint...........................
50061..0 # Skip No BigInt Lib configured
5007skipped: No BigInt Lib configured
5008t/pmc/bignum...........................
50091..0 # Skip No BigNum PMC enabled
5010skipped: No BigNum PMC enabled
5011t/pmc/boolean..........................ok
5012t/pmc/bound_nci........................ok
5013t/pmc/callsignature....................ok
5014t/pmc/capture..........................ok
5015t/pmc/class............................
5016not ok 28 # TODO add_method() invoking method added to class works
5017ok
5018t/pmc/codestring.......................ok
5019t/pmc/complex..........................
5020ok 58 # SKIP div by zero not caught
5021ok 59 # SKIP div by zero not caught
5022ok 60 # SKIP div by zero not caught
5023ok 86 # SKIP instantiate n/y
5024ok 87 # SKIP instantiate n/y
5025ok 88 # SKIP instantiate n/y
5026ok 89 # SKIP instantiate n/y
5027ok 126 # SKIP inf is not platform-independent
5028ok 465 # SKIP add using subclass of Complex - RT #59630
5029ok 466 # SKIP add using subclass of Complex - RT #59630
5030ok 467 # SKIP add using subclass of Complex - RT #59630
5031ok
5032t/pmc/config...........................ok
5033t/pmc/continuation.....................ok
5034t/pmc/coroutine........................
5035not ok 9 - Call an exited coroutine # TODO goes one iteration too far.
5036ok
5037t/pmc/cpointer.........................ok
5038t/pmc/default..........................
5039not ok 1 - new # TODO not implemeted
5040ok
5041t/pmc/env..............................ok
5042t/pmc/eval.............................ok
5043t/pmc/eventhandler.....................ok
5044t/pmc/exception........................
5045not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans
5046not ok 25 - pushaction: error while handling error # TODO runloop shenanigans
5047not ok 27 - invoke handler in calling sub # TODO deprecate rethrow
5048not ok 30 - catch ex from C-level MULTI function # TODO broken
5049ok
5050t/pmc/exceptionhandler.................ok
5051t/pmc/exporter.........................ok
5052t/pmc/file.............................ok
5053t/pmc/filehandle.......................
5054ok 3 # SKIP no asynch calls yet
5055not ok 8 - record_separator # TODO not yet implemented
5056ok
5057t/pmc/fixedbooleanarray................ok
5058t/pmc/fixedfloatarray..................ok
5059t/pmc/fixedintegerarray................ok
5060t/pmc/fixedpmcarray....................ok
5061t/pmc/fixedstringarray.................ok
5062t/pmc/float............................ok
5063t/pmc/freeze...........................ok
5064t/pmc/globals..........................ok
5065t/pmc/hash.............................ok
5066t/pmc/integer..........................ok
5067t/pmc/io...............................
5068not ok 1 - IO on some invalid types # TODO IO on some invalid types
5069ok 8 # SKIP clone not finished yet
5070not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433
5071not ok 40 - string read/write handle # TODO no stringhandle yet
5072ok
5073t/pmc/io_iterator......................
5074not ok 1 - new # TODO not yet implemented
5075not ok 2 - shift # TODO not yet implemented
5076not ok 3 - get_bool (vtable) # TODO not yet implemented
5077ok
5078t/pmc/io_status........................
5079not ok 1 - new # TODO not yet implemented
5080not ok 2 - get_integer (vtable) # TODO not yet implemented
5081not ok 3 - get_bool (vtable) # TODO not yet implemented
5082not ok 4 - return # TODO not yet implemented
5083not ok 5 - error # TODO not yet implemented
5084not ok 6 - throw # TODO not yet implemented
5085ok
5086t/pmc/iterator.........................
5087ok 13 # SKIP N/Y: length of rest of array
5088not ok 16 - adding keys during iteration # TODO adding keys during iteration
5089not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points'
5090ok
5091t/pmc/key..............................
5092not ok 10 # TODO register and non-register string keys should be COW (RT #60128)
5093ok
5094t/pmc/lexinfo..........................ok
5095t/pmc/lexpad...........................ok
5096t/pmc/managedstruct....................ok
5097t/pmc/multidispatch....................
5098not ok 22 - MMD on PMC types - Any # TODO RT #41374
5099not ok 25 - add as method - inherited # TODO RT #41374
5100not ok 32 - use a core func for an object # TODO RT #59628
5101ok
5102t/pmc/multisub.........................ok
5103t/pmc/namespace........................
5104not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17
5105ok
5106t/pmc/nci..............................
5107not ok 42 - nci_cb_C1 - PASM # TODO RT #49718, add scheduler tasks to JIT
5108not ok 43 - nci_cb_C1 - PIR # TODO RT #49718, add scheduler tasks to JIT
5109not ok 44 - nci_cb_C2 - PASM # TODO RT #49718, add scheduler tasks to JIT
5110not ok 45 - nci_cb_C3 - PIR # TODO RT #49718, add scheduler tasks to JIT
5111not ok 46 - nci_cb_D1 - PASM # TODO RT #49718, add scheduler tasks to JIT
5112not ok 47 - nci_cb_D2 - PASM # TODO RT #49718, add scheduler tasks to JIT
5113not ok 48 - nci_cb_D2 - PIR # TODO RT #49718, add scheduler tasks to JIT
5114not ok 49 - nci_cb_D3 - PIR # TODO RT #49718, add scheduler tasks to JIT
5115ok
5116t/pmc/null.............................ok
5117t/pmc/object-meths.....................
5118ok 14 # SKIP currently broken
5119ok 25 # SKIP no bound NCI method
5120ok
5121t/pmc/object-mro.......................ok
5122t/pmc/object...........................ok
5123t/pmc/objects..........................ok
5124t/pmc/orderedhash......................ok
5125t/pmc/os...............................ok
5126t/pmc/packfile.........................ok
5127t/pmc/packfileconstanttable............
5128not ok 3 - get_type, get_*_keyed_int # TODO See TT #385.
5129ok
5130t/pmc/packfiledirectory................ok
5131t/pmc/packfilefixupentry...............ok
5132t/pmc/packfilefixuptable...............ok
5133t/pmc/packfilerawsegment...............ok
5134t/pmc/packfilesegment..................ok
5135t/pmc/parrotclass......................ok
5136t/pmc/parrotinterpreter................ok
5137t/pmc/parrotio.........................
5138not ok 2 - open and close - synchronous # TODO not yet implemented
5139ok 3 # SKIP no asynch calls yet
5140not ok 4 - print, read, and readline - synchronous # TODO not yet implemented
5141not ok 5 - record_separator # TODO not yet implemented
5142not ok 6 - buffer_type # TODO not yet implemented
5143ok
5144t/pmc/parrotlibrary....................ok
5145t/pmc/parrotobject.....................ok
5146t/pmc/parrotrunningthread..............ok
5147t/pmc/parrotthread.....................ok
5148t/pmc/pccmethod_test...................ok
5149t/pmc/pmc..............................ok
5150t/pmc/pmcproxy.........................ok
5151t/pmc/pointer..........................ok
5152t/pmc/prop.............................ok
5153t/pmc/random...........................ok
5154t/pmc/ref..............................ok
5155t/pmc/resizablebooleanarray............ok
5156t/pmc/resizablefloatarray..............ok
5157t/pmc/resizableintegerarray............ok
5158t/pmc/resizablepmcarray................ok
5159t/pmc/resizablestringarray.............ok
5160t/pmc/retcontinuation..................ok
5161t/pmc/ro...............................
5162not ok 8 - ResizablePMCArray -- Recursive # TODO 1
5163ok
5164t/pmc/role.............................ok
5165t/pmc/scalar...........................
5166ok 1 # SKIP doesn't work yet
5167ok
5168t/pmc/scheduler........................ok
5169t/pmc/schedulermessage.................ok
5170t/pmc/sharedref........................ok
5171t/pmc/signal...........................
51721..0 # Skip Signals currently disabled
5173skipped: Signals currently disabled
5174t/pmc/slice............................
5175not ok 2 - bug with slice bits # TODO parser
5176ok
5177t/pmc/string...........................ok
5178t/pmc/stringhandle.....................
5179ok 3 # SKIP no asynch calls yet
5180not ok 9 - record_separator # TODO not yet implemented
5181ok
5182t/pmc/sub..............................ok
5183t/pmc/sys..............................ok
5184t/pmc/task.............................ok
5185t/pmc/threads..........................
5186not ok 11 - CLONE_CODE | CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511
5187not ok 14 - globals + constant table subs issue # TODO Broken with JIT
5188not ok 15 - CLONE_CODE|CLONE_GLOBALS|CLONE_HLL|CLONE_LIBRARIES # TODO RT #41373
5189ok
5190t/pmc/timer............................
5191not ok 5 - Timer setup - initializer/start/repeat # TODO RT #49718, add scheduler features to JIT
5192ok
5193t/pmc/undef............................ok
5194t/pmc/unmanagedstruct..................ok
5195t/oo/attributes........................ok
5196t/oo/composition.......................ok
5197t/oo/inheritance.......................ok
5198t/oo/isa...............................ok
5199t/oo/metamodel.........................
5200not ok 6 # TODO tail attribute has a type
5201not ok 12 # TODO new opcode makes working objects
5202ok
5203t/oo/methods...........................ok
5204t/oo/mro-c3............................ok
5205t/oo/names.............................ok
5206t/oo/new...............................ok
5207t/oo/ops...............................ok
5208t/oo/proxy.............................ok
5209t/oo/subclass..........................ok
5210t/oo/vtableoverride....................ok
5211t/native_pbc/header....................
52121..0 # Skip pending robust testing strategy, TT #357
5213skipped: pending robust testing strategy, TT #357
5214t/native_pbc/integer...................
52151..0 # Skip pending robust testing strategy, TT #357
5216skipped: pending robust testing strategy, TT #357
5217t/native_pbc/number....................
52181..0 # Skip pending robust testing strategy, TT #357
5219skipped: pending robust testing strategy, TT #357
5220t/native_pbc/string....................
52211..0 # Skip pending robust testing strategy, TT #357
5222skipped: pending robust testing strategy, TT #357
5223t/dynpmc/dynlexpad.....................
5224not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads
5225ok
5226t/dynpmc/foo...........................
5227ok 6 # SKIP No BigInt Lib configured
5228ok
5229t/dynpmc/gdbmhash......................
52301..0 # Skip No gdbm library available
5231skipped: No gdbm library available
5232t/dynpmc/md2...........................ok
5233t/dynpmc/md4...........................ok
5234t/dynpmc/md5...........................ok
5235t/dynpmc/pair..........................ok
5236t/dynpmc/rational......................ok
5237t/dynpmc/ripemd160.....................ok
5238t/dynpmc/rotest........................ok
5239t/dynpmc/sha...........................ok
5240t/dynpmc/sha1..........................ok
5241t/dynpmc/sha256........................
52421..0 # Skip Too old library
5243skipped: Too old library
5244t/dynpmc/sha512........................
52451..0 # Skip Too old library
5246skipped: Too old library
5247t/dynpmc/subclass_with_pir_method......
5248not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces
5249not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces
5250ok
5251t/dynpmc/subproxy......................ok
5252t/dynoplibs/dan........................ok
5253t/dynoplibs/myops......................
5254not ok 4 - a short cheating quine # TODO broken with JIT
5255not ok 5 - one alarm # TODO RT #49718, add scheduler features to JIT
5256not ok 6 - three alarm # TODO RT #49718, add scheduler features to JIT
5257not ok 7 - repeating alarm # TODO RT #49718, add scheduler features to JIT
5258ok
5259t/compilers/pct/complete_workflow......ok
5260t/compilers/pct/past...................ok
5261t/compilers/pct/pct_hllcompiler........ok
5262t/compilers/pct/post...................ok
5263t/compilers/pge/00-basic...............ok
5264t/compilers/pge/02-match...............ok
5265t/compilers/pge/03-optable.............ok
5266t/compilers/pge/04-compile.............ok
5267t/compilers/pge/06-grammar.............ok
5268t/compilers/pge/pge-hs.................ok
5269t/compilers/pge/pge....................ok
5270t/compilers/pge/pge_examples...........
5271#   Failed test 'parse FASTA'
5272#   at t/compilers/pge/pge_examples.t line 55.
5273# Exited with error code: [SIGNAL 11]
5274# Received:
5275#
5276# Expected:
5277# >gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus]
5278# LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
5279# EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG
5280# LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL
5281# GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX
5282# IENY
5283# >poly_a teasing the parser with DNA
5284# aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
5285#
5286# Looks like you failed 1 test of 2.
5287 Dubious, test returned 1 (wstat 256, 0x100)
5288 Failed 1/2 subtests
5289t/compilers/pge/pge_globs..............ok
5290t/compilers/pge/pge_text...............ok
5291t/compilers/pge/pge_util...............ok
5292t/compilers/pge/p5regex/p5rx...........
5293not ok 116 # TODO [re_tests:116] character class in enumeration
5294not ok 119 # TODO [re_tests:119] character class in enumeration
5295not ok 120 # TODO [re_tests:120] character class in enumeration
5296not ok 123 # TODO [re_tests:123] character class in enumeration
5297not ok 124 # TODO [re_tests:124] character class in enumeration
5298not ok 127 # TODO [re_tests:127] character class in enumeration
5299ok 138 # SKIP [re_tests:138] parser bug
5300ok 139 # SKIP [re_tests:139] broken col 4?
5301ok 143 # SKIP [re_tests:143] bug or error
5302ok 144 # SKIP [re_tests:144] bug or error
5303ok 148 # SKIP [re_tests:148] bug or error
5304ok 149 # SKIP [re_tests:149] bug or error
5305ok 155 # SKIP [re_tests:155] bug or error
5306ok 167 # SKIP [re_tests:167] bug or error
5307not ok 234 # TODO [re_tests:234] unknown reason
5308not ok 235 # TODO [re_tests:235] unknown reason
5309not ok 236 # TODO [re_tests:236] unknown reason
5310not ok 246 # TODO [re_tests:246] unknown reason
5311not ok 247 # TODO [re_tests:247] unknown reason
5312ok 248 # SKIP [re_tests:248] bug or error
5313ok 249 # SKIP [re_tests:249] bug or error
5314ok 252 # SKIP [re_tests:252] bug or error
5315not ok 254 # TODO [re_tests:254] unknown reason
5316not ok 256 # TODO [re_tests:256] unknown reason
5317not ok 257 # TODO [re_tests:257] unknown reason
5318ok 264 # SKIP [re_tests:264] trailing modifiers
5319ok 265 # SKIP [re_tests:265] trailing modifiers
5320ok 266 # SKIP [re_tests:266] trailing modifiers
5321ok 267 # SKIP [re_tests:267] trailing modifiers
5322ok 268 # SKIP [re_tests:268] trailing modifiers
5323ok 269 # SKIP [re_tests:269] trailing modifiers
5324ok 270 # SKIP [re_tests:270] trailing modifiers
5325ok 271 # SKIP [re_tests:271] trailing modifiers
5326ok 272 # SKIP [re_tests:272] trailing modifiers
5327ok 273 # SKIP [re_tests:273] trailing modifiers
5328ok 274 # SKIP [re_tests:274] trailing modifiers
5329ok 275 # SKIP [re_tests:275] trailing modifiers
5330ok 276 # SKIP [re_tests:276] trailing modifiers
5331ok 277 # SKIP [re_tests:277] trailing modifiers
5332ok 278 # SKIP [re_tests:278] trailing modifiers
5333ok 279 # SKIP [re_tests:279] trailing modifiers
5334ok 280 # SKIP [re_tests:280] trailing modifiers
5335ok 281 # SKIP [re_tests:281] trailing modifiers
5336ok 282 # SKIP [re_tests:282] trailing modifiers
5337ok 283 # SKIP [re_tests:283] trailing modifiers
5338ok 284 # SKIP [re_tests:284] trailing modifiers
5339ok 285 # SKIP [re_tests:285] trailing modifiers
5340ok 286 # SKIP [re_tests:286] trailing modifiers
5341ok 287 # SKIP [re_tests:287] trailing modifiers
5342ok 288 # SKIP [re_tests:288] trailing modifiers
5343ok 289 # SKIP [re_tests:289] trailing modifiers
5344ok 290 # SKIP [re_tests:290] trailing modifiers
5345ok 291 # SKIP [re_tests:291] trailing modifiers
5346ok 292 # SKIP [re_tests:292] trailing modifiers
5347ok 293 # SKIP [re_tests:293] trailing modifiers
5348ok 294 # SKIP [re_tests:294] trailing modifiers
5349ok 295 # SKIP [re_tests:295] trailing modifiers
5350ok 296 # SKIP [re_tests:296] trailing modifiers
5351ok 297 # SKIP [re_tests:297] trailing modifiers
5352ok 298 # SKIP [re_tests:298] trailing modifiers
5353ok 299 # SKIP [re_tests:299] trailing modifiers
5354ok 300 # SKIP [re_tests:300] trailing modifiers
5355ok 301 # SKIP [re_tests:301] trailing modifiers
5356ok 302 # SKIP [re_tests:302] trailing modifiers
5357ok 303 # SKIP [re_tests:303] trailing modifiers
5358ok 304 # SKIP [re_tests:304] trailing modifiers
5359ok 305 # SKIP [re_tests:305] trailing modifiers
5360ok 306 # SKIP [re_tests:306] trailing modifiers
5361ok 307 # SKIP [re_tests:307] trailing modifiers
5362ok 308 # SKIP [re_tests:308] bug or error
5363ok 309 # SKIP [re_tests:309] bug or error
5364ok 310 # SKIP [re_tests:310] bug or error
5365ok 311 # SKIP [re_tests:311] trailing modifiers
5366ok 312 # SKIP [re_tests:312] trailing modifiers
5367ok 313 # SKIP [re_tests:313] trailing modifiers
5368ok 314 # SKIP [re_tests:314] trailing modifiers
5369ok 315 # SKIP [re_tests:315] trailing modifiers
5370ok 316 # SKIP [re_tests:316] trailing modifiers
5371ok 317 # SKIP [re_tests:317] trailing modifiers
5372ok 318 # SKIP [re_tests:318] trailing modifiers
5373ok 319 # SKIP [re_tests:319] trailing modifiers
5374ok 320 # SKIP [re_tests:320] trailing modifiers
5375ok 321 # SKIP [re_tests:321] trailing modifiers
5376ok 322 # SKIP [re_tests:322] bug or error
5377ok 323 # SKIP [re_tests:323] bug or error
5378ok 324 # SKIP [re_tests:324] trailing modifiers
5379ok 325 # SKIP [re_tests:325] bug or error
5380ok 326 # SKIP [re_tests:326] trailing modifiers
5381ok 327 # SKIP [re_tests:327] trailing modifiers
5382ok 328 # SKIP [re_tests:328] trailing modifiers
5383ok 329 # SKIP [re_tests:329] trailing modifiers
5384ok 330 # SKIP [re_tests:330] bug or error
5385ok 331 # SKIP [re_tests:331] bug or error
5386ok 332 # SKIP [re_tests:332] trailing modifiers
5387ok 333 # SKIP [re_tests:333] trailing modifiers
5388ok 334 # SKIP [re_tests:334] trailing modifiers
5389ok 335 # SKIP [re_tests:335] trailing modifiers
5390ok 336 # SKIP [re_tests:336] bug or error
5391ok 337 # SKIP [re_tests:337] trailing modifiers
5392ok 338 # SKIP [re_tests:338] trailing modifiers
5393ok 339 # SKIP [re_tests:339] trailing modifiers
5394ok 340 # SKIP [re_tests:340] trailing modifiers
5395ok 341 # SKIP [re_tests:341] trailing modifiers
5396ok 342 # SKIP [re_tests:342] trailing modifiers
5397ok 343 # SKIP [re_tests:343] trailing modifiers
5398ok 344 # SKIP [re_tests:344] trailing modifiers
5399ok 345 # SKIP [re_tests:345] trailing modifiers
5400ok 346 # SKIP [re_tests:346] trailing modifiers
5401ok 347 # SKIP [re_tests:347] bug or error
5402ok 348 # SKIP [re_tests:348] trailing modifiers
5403ok 349 # SKIP [re_tests:349] trailing modifiers
5404ok 350 # SKIP [re_tests:350] trailing modifiers
5405ok 351 # SKIP [re_tests:351] trailing modifiers
5406ok 352 # SKIP [re_tests:352] trailing modifiers
5407ok 353 # SKIP [re_tests:353] trailing modifiers
5408ok 354 # SKIP [re_tests:354] trailing modifiers
5409ok 355 # SKIP [re_tests:355] trailing modifiers
5410ok 356 # SKIP [re_tests:356] trailing modifiers
5411ok 357 # SKIP [re_tests:357] trailing modifiers
5412ok 358 # SKIP [re_tests:358] trailing modifiers
5413ok 359 # SKIP [re_tests:359] trailing modifiers
5414ok 360 # SKIP [re_tests:360] trailing modifiers
5415ok 361 # SKIP [re_tests:361] trailing modifiers
5416ok 362 # SKIP [re_tests:362] trailing modifiers
5417ok 363 # SKIP [re_tests:363] trailing modifiers
5418ok 364 # SKIP [re_tests:364] trailing modifiers
5419ok 365 # SKIP [re_tests:365] trailing modifiers
5420ok 366 # SKIP [re_tests:366] trailing modifiers
5421ok 367 # SKIP [re_tests:367] trailing modifiers
5422ok 368 # SKIP [re_tests:368] trailing modifiers
5423ok 369 # SKIP [re_tests:369] trailing modifiers
5424ok 370 # SKIP [re_tests:370] trailing modifiers
5425ok 371 # SKIP [re_tests:371] trailing modifiers
5426ok 372 # SKIP [re_tests:372] trailing modifiers
5427ok 373 # SKIP [re_tests:373] trailing modifiers
5428ok 374 # SKIP [re_tests:374] trailing modifiers
5429ok 375 # SKIP [re_tests:375] trailing modifiers
5430ok 376 # SKIP [re_tests:376] trailing modifiers
5431ok 377 # SKIP [re_tests:377] trailing modifiers
5432ok 378 # SKIP [re_tests:378] trailing modifiers
5433ok 379 # SKIP [re_tests:379] trailing modifiers
5434ok 380 # SKIP [re_tests:380] trailing modifiers
5435ok 381 # SKIP [re_tests:381] trailing modifiers
5436ok 382 # SKIP [re_tests:382] trailing modifiers
5437ok 383 # SKIP [re_tests:383] trailing modifiers
5438ok 384 # SKIP [re_tests:384] trailing modifiers
5439ok 385 # SKIP [re_tests:385] trailing modifiers
5440ok 386 # SKIP [re_tests:386] trailing modifiers
5441ok 387 # SKIP [re_tests:387] trailing modifiers
5442ok 388 # SKIP [re_tests:388] trailing modifiers
5443ok 389 # SKIP [re_tests:389] trailing modifiers
5444ok 390 # SKIP [re_tests:390] trailing modifiers
5445ok 391 # SKIP [re_tests:391] trailing modifiers
5446ok 392 # SKIP [re_tests:392] trailing modifiers
5447ok 393 # SKIP [re_tests:393] trailing modifiers
5448ok 394 # SKIP [re_tests:394] trailing modifiers
5449ok 395 # SKIP [re_tests:395] trailing modifiers
5450not ok 396 # TODO [re_tests:396] unknown reason
5451not ok 397 # TODO [re_tests:397] unknown reason
5452not ok 398 # TODO [re_tests:398] unknown reason
5453ok 408 # SKIP [re_tests:408] bug or error
5454not ok 419 # TODO [re_tests:419] unknown reason
5455not ok 422 # TODO [re_tests:422] unknown reason
5456not ok 429 # TODO [re_tests:429] unknown reason
5457not ok 432 # TODO [re_tests:432] unknown reason
5458not ok 434 # TODO [re_tests:434] unknown reason
5459not ok 435 # TODO [re_tests:435] unknown reason
5460ok 436 # SKIP [re_tests:436] bug or error
5461not ok 439 # TODO [re_tests:439] unknown reason
5462not ok 446 # TODO [re_tests:446] unknown reason
5463not ok 447 # TODO [re_tests:447] unknown reason
5464not ok 448 # TODO [re_tests:448] unknown reason
5465not ok 449 # TODO [re_tests:449] unknown reason
5466not ok 452 # TODO [re_tests:452] unknown reason
5467not ok 453 # TODO [re_tests:453] unknown reason
5468not ok 454 # TODO [re_tests:454] unknown reason
5469not ok 455 # TODO [re_tests:455] unknown reason
5470ok 458 # SKIP [re_tests:458] unknown reason
5471ok 459 # SKIP [re_tests:459] unknown reason
5472ok 460 # SKIP [re_tests:460] unknown reason
5473ok 461 # SKIP [re_tests:461] unknown reason
5474ok 462 # SKIP [re_tests:462] unknown reason
5475ok 463 # SKIP [re_tests:463] unknown reason
5476ok 464 # SKIP [re_tests:464] unknown reason
5477ok 465 # SKIP [re_tests:465] unknown reason
5478ok 466 # SKIP [re_tests:466] unknown reason
5479ok 467 # SKIP [re_tests:467] unknown reason
5480ok 468 # SKIP [re_tests:468] unknown reason
5481ok 469 # SKIP [re_tests:469] unknown reason
5482ok 470 # SKIP [re_tests:470] unknown reason
5483ok 471 # SKIP [re_tests:471] unknown reason
5484ok 472 # SKIP [re_tests:472] unknown reason
5485ok 473 # SKIP [re_tests:473] unknown reason
5486ok 474 # SKIP [re_tests:474] unknown reason
5487ok 475 # SKIP [re_tests:475] unknown reason
5488ok 476 # SKIP [re_tests:476] unknown reason
5489ok 477 # SKIP [re_tests:477] unknown reason
5490ok 478 # SKIP [re_tests:478] unknown reason
5491ok 479 # SKIP [re_tests:479] unknown reason
5492ok 480 # SKIP [re_tests:480] unknown reason
5493ok 483 # SKIP [re_tests:483]
5494ok 484 # SKIP [re_tests:484]
5495ok 487 # SKIP [re_tests:487] bug or error
5496ok 488 # SKIP [re_tests:488] bug or error
5497ok 489 # SKIP [re_tests:489] bug or error
5498ok 490 # SKIP [re_tests:490] bug or error
5499ok 491 # SKIP [re_tests:491] kills a parrot
5500ok 492 # SKIP [re_tests:492] bug or error
5501ok 493 # SKIP [re_tests:493] kills a parrot
5502not ok 495 # TODO [re_tests:495] unknown reason
5503ok 496 # SKIP [re_tests:496]
5504not ok 498 # TODO [re_tests:498] unknown reason
5505not ok 500 # TODO [re_tests:500] unknown reason
5506not ok 501 # TODO [re_tests:501] unknown reason
5507ok 502 # SKIP [re_tests:502] unknown reason
5508not ok 503 # TODO [re_tests:503] unknown reason
5509not ok 504 # TODO [re_tests:504] unknown reason
5510not ok 505 # TODO [re_tests:505] unknown reason
5511not ok 506 # TODO [re_tests:506] unknown reason
5512not ok 507 # TODO [re_tests:507] unknown reason
5513not ok 508 # TODO [re_tests:508] unknown reason
5514not ok 509 # TODO [re_tests:509] unknown reason
5515not ok 510 # TODO [re_tests:510] unknown reason
5516not ok 511 # TODO [re_tests:511] unknown reason
5517not ok 512 # TODO [re_tests:512] unknown reason
5518not ok 515 # TODO [re_tests:515] unknown reason
5519not ok 521 # TODO [re_tests:521] unknown reason
5520not ok 522 # TODO [re_tests:522] unknown reason
5521not ok 523 # TODO [re_tests:523] unknown reason
5522not ok 524 # TODO [re_tests:524] unknown reason
5523not ok 527 # TODO [re_tests:527] unknown reason
5524not ok 528 # TODO [re_tests:528] unknown reason
5525ok 531 # SKIP [re_tests:531] bug or error
5526ok 532 # SKIP [re_tests:532] bug or error
5527not ok 535 # TODO [re_tests:535] unknown reason
5528not ok 536 # TODO [re_tests:536] unknown reason
5529not ok 539 # TODO [re_tests:539] unknown reason
5530not ok 540 # TODO [re_tests:540] unknown reason
5531not ok 541 # TODO [re_tests:541] unknown reason
5532not ok 544 # TODO [re_tests:544] unknown reason
5533not ok 545 # TODO [re_tests:545] unknown reason
5534ok 556 # SKIP [re_tests:556] kills a parrot
5535ok 557 # SKIP [re_tests:557] kills a parrot
5536not ok 559 # TODO [re_tests:559] unknown reason
5537ok 563 # SKIP [re_tests:563] bug or error
5538ok 564 # SKIP [re_tests:564] bug or error
5539ok 566 # SKIP [re_tests:566] bug or error
5540ok 568 # SKIP [re_tests:568] kills a parrot
5541ok 569 # SKIP [re_tests:569] kills a parrot
5542ok 570 # SKIP [re_tests:570] kills a parrot
5543ok 571 # SKIP [re_tests:571] kills a parrot
5544ok 572 # SKIP [re_tests:572] kills a parrot
5545ok 573 # SKIP [re_tests:573] kills a parrot
5546ok 574 # SKIP [re_tests:574] kills a parrot
5547ok 575 # SKIP [re_tests:575] kills a parrot
5548ok 576 # SKIP [re_tests:576] kills a parrot
5549ok 577 # SKIP [re_tests:577] kills a parrot
5550ok 578 # SKIP [re_tests:578] kills a parrot
5551ok 579 # SKIP [re_tests:579] kills a parrot
5552ok 580 # SKIP [re_tests:580] kills a parrot
5553ok 581 # SKIP [re_tests:581] kills a parrot
5554ok 582 # SKIP [re_tests:582] kills a parrot
5555ok 583 # SKIP [re_tests:583] kills a parrot
5556ok 584 # SKIP [re_tests:584] kills a parrot
5557ok 585 # SKIP [re_tests:585] kills a parrot
5558ok 586 # SKIP [re_tests:586] kills a parrot
5559ok 587 # SKIP [re_tests:587] kills a parrot
5560ok 588 # SKIP [re_tests:588] kills a parrot
5561ok 589 # SKIP [re_tests:589] kills a parrot
5562ok 590 # SKIP [re_tests:590] kills a parrot
5563ok 591 # SKIP [re_tests:591] kills a parrot
5564ok 592 # SKIP [re_tests:592] kills a parrot
5565ok 593 # SKIP [re_tests:593] bug or error
5566ok 594 # SKIP [re_tests:594] bug or error
5567not ok 595 # TODO [re_tests:595] unknown reason
5568not ok 596 # TODO [re_tests:596] unknown reason
5569ok 597 # SKIP [re_tests:597] unknown reason
5570ok 598 # SKIP [re_tests:598] bug or error
5571ok 599 # SKIP [re_tests:599] bug or error
5572not ok 600 # TODO [re_tests:600] unknown reason
5573not ok 601 # TODO [re_tests:601] unknown reason
5574not ok 603 # TODO [re_tests:603] unknown reason
5575not ok 604 # TODO [re_tests:604] unknown reason
5576not ok 606 # TODO [re_tests:606] unknown reason
5577not ok 607 # TODO [re_tests:607] unknown reason
5578ok 609 # SKIP [re_tests:609] unknown reason
5579ok 610 # SKIP [re_tests:610] unknown reason
5580ok 611 # SKIP [re_tests:611] unknown reason
5581ok 612 # SKIP [re_tests:612] unknown reason
5582ok 613 # SKIP [re_tests:613] unknown reason
5583ok 614 # SKIP [re_tests:614] unknown reason
5584ok 615 # SKIP [re_tests:615] unknown reason
5585ok 616 # SKIP [re_tests:616] unknown reason
5586ok 617 # SKIP [re_tests:617] unknown reason
5587not ok 621 # TODO [re_tests:621] unknown reason
5588not ok 623 # TODO [re_tests:623] unknown reason
5589not ok 624 # TODO [re_tests:624] unknown reason
5590not ok 625 # TODO [re_tests:625] unknown reason
5591ok 627 # SKIP [re_tests:627] unknown reason
5592ok 628 # SKIP [re_tests:628] unknown reason
5593ok 629 # SKIP [re_tests:629] unknown reason
5594ok 630 # SKIP [re_tests:630] unknown reason
5595ok 631 # SKIP [re_tests:631] unknown reason
5596ok 632 # SKIP [re_tests:632] unknown reason
5597ok 633 # SKIP [re_tests:633] unknown reason
5598ok 634 # SKIP [re_tests:634] unknown reason
5599ok 635 # SKIP [re_tests:635] unknown reason
5600not ok 639 # TODO [re_tests:639] unknown reason
5601not ok 641 # TODO [re_tests:641] unknown reason
5602not ok 642 # TODO [re_tests:642] unknown reason
5603not ok 643 # TODO [re_tests:643] unknown reason
5604ok 645 # SKIP [re_tests:645] unknown reason
5605ok 646 # SKIP [re_tests:646] unknown reason
5606ok 647 # SKIP [re_tests:647] unknown reason
5607ok 648 # SKIP [re_tests:648] unknown reason
5608ok 649 # SKIP [re_tests:649] unknown reason
5609ok 650 # SKIP [re_tests:650] unknown reason
5610ok 651 # SKIP [re_tests:651] unknown reason
5611ok 652 # SKIP [re_tests:652] unknown reason
5612ok 653 # SKIP [re_tests:653] unknown reason
5613ok 663 # SKIP [re_tests:663] unknown reason
5614ok 664 # SKIP [re_tests:664] unknown reason
5615ok 665 # SKIP [re_tests:665] unknown reason
5616ok 666 # SKIP [re_tests:666] unknown reason
5617ok 667 # SKIP [re_tests:667] unknown reason
5618ok 668 # SKIP [re_tests:668] unknown reason
5619ok 669 # SKIP [re_tests:669] unknown reason
5620ok 670 # SKIP [re_tests:670] unknown reason
5621ok 671 # SKIP [re_tests:671] unknown reason
5622ok 681 # SKIP [re_tests:681] unknown reason
5623ok 682 # SKIP [re_tests:682] unknown reason
5624ok 683 # SKIP [re_tests:683] unknown reason
5625ok 684 # SKIP [re_tests:684] unknown reason
5626ok 685 # SKIP [re_tests:685] unknown reason
5627ok 686 # SKIP [re_tests:686] unknown reason
5628ok 687 # SKIP [re_tests:687] unknown reason
5629ok 688 # SKIP [re_tests:688] unknown reason
5630ok 689 # SKIP [re_tests:689] unknown reason
5631not ok 693 # TODO [re_tests:693] unknown reason
5632not ok 695 # TODO [re_tests:695] unknown reason
5633not ok 696 # TODO [re_tests:696] unknown reason
5634not ok 697 # TODO [re_tests:697] unknown reason
5635ok 699 # SKIP [re_tests:699] unknown reason
5636ok 700 # SKIP [re_tests:700] unknown reason
5637ok 701 # SKIP [re_tests:701] unknown reason
5638ok 702 # SKIP [re_tests:702] unknown reason
5639ok 703 # SKIP [re_tests:703] unknown reason
5640ok 704 # SKIP [re_tests:704] unknown reason
5641ok 705 # SKIP [re_tests:705] unknown reason
5642ok 706 # SKIP [re_tests:706] unknown reason
5643ok 707 # SKIP [re_tests:707] unknown reason
5644ok 717 # SKIP [re_tests:717] unknown reason
5645ok 718 # SKIP [re_tests:718] unknown reason
5646ok 719 # SKIP [re_tests:719] unknown reason
5647ok 720 # SKIP [re_tests:720] unknown reason
5648ok 721 # SKIP [re_tests:721] unknown reason
5649ok 722 # SKIP [re_tests:722] unknown reason
5650ok 723 # SKIP [re_tests:723] unknown reason
5651ok 724 # SKIP [re_tests:724] unknown reason
5652ok 725 # SKIP [re_tests:725] unknown reason
5653ok 735 # SKIP [re_tests:735] unknown reason
5654ok 736 # SKIP [re_tests:736] unknown reason
5655ok 737 # SKIP [re_tests:737] unknown reason
5656ok 738 # SKIP [re_tests:738] unknown reason
5657ok 739 # SKIP [re_tests:739] unknown reason
5658ok 740 # SKIP [re_tests:740] unknown reason
5659ok 741 # SKIP [re_tests:741] unknown reason
5660ok 742 # SKIP [re_tests:742] unknown reason
5661ok 743 # SKIP [re_tests:743] unknown reason
5662not ok 747 # TODO [re_tests:747] unknown reason
5663not ok 749 # TODO [re_tests:749] unknown reason
5664not ok 750 # TODO [re_tests:750] unknown reason
5665not ok 751 # TODO [re_tests:751] unknown reason
5666ok 753 # SKIP [re_tests:753] unknown reason
5667ok 754 # SKIP [re_tests:754] unknown reason
5668ok 755 # SKIP [re_tests:755] unknown reason
5669ok 756 # SKIP [re_tests:756] unknown reason
5670ok 757 # SKIP [re_tests:757] unknown reason
5671ok 758 # SKIP [re_tests:758] unknown reason
5672ok 759 # SKIP [re_tests:759] unknown reason
5673ok 760 # SKIP [re_tests:760] unknown reason
5674ok 761 # SKIP [re_tests:761] unknown reason
5675ok 771 # SKIP [re_tests:771] unknown reason
5676ok 772 # SKIP [re_tests:772] unknown reason
5677ok 773 # SKIP [re_tests:773] unknown reason
5678ok 774 # SKIP [re_tests:774] unknown reason
5679ok 775 # SKIP [re_tests:775] unknown reason
5680ok 776 # SKIP [re_tests:776] unknown reason
5681ok 777 # SKIP [re_tests:777] unknown reason
5682ok 778 # SKIP [re_tests:778] unknown reason
5683ok 779 # SKIP [re_tests:779] unknown reason
5684ok 789 # SKIP [re_tests:789] unknown reason
5685ok 790 # SKIP [re_tests:790] unknown reason
5686ok 791 # SKIP [re_tests:791] unknown reason
5687ok 792 # SKIP [re_tests:792] unknown reason
5688ok 793 # SKIP [re_tests:793] unknown reason
5689ok 794 # SKIP [re_tests:794] unknown reason
5690ok 795 # SKIP [re_tests:795] unknown reason
5691ok 796 # SKIP [re_tests:796] unknown reason
5692ok 797 # SKIP [re_tests:797] unknown reason
5693ok 800 # SKIP [re_tests:800]
5694not ok 801 # TODO [re_tests:801] unknown reason
5695ok 802 # SKIP [re_tests:802]
5696ok 803 # SKIP [re_tests:803]
5697ok 805 # SKIP [re_tests:805]
5698ok 806 # SKIP [re_tests:806] hangs a parrot
5699ok 807 # SKIP [re_tests:807] hangs a parrot
5700ok 808 # SKIP [re_tests:808] hangs a parrot
5701ok 809 # SKIP [re_tests:809] hangs a parrot
5702ok 810 # SKIP [re_tests:810] hangs a parrot
5703ok 811 # SKIP [re_tests:811] hangs a parrot
5704ok 812 # SKIP [re_tests:812] hangs a parrot
5705ok 813 # SKIP [re_tests:813] hangs a parrot
5706ok 814 # SKIP [re_tests:814] hangs a parrot
5707ok 815 # SKIP [re_tests:815] hangs a parrot
5708ok 816 # SKIP [re_tests:816] hangs a parrot
5709ok 817 # SKIP [re_tests:817] hangs a parrot
5710ok 818 # SKIP [re_tests:818] hangs a parrot
5711ok 819 # SKIP [re_tests:819] hangs a parrot
5712ok 820 # SKIP [re_tests:820] hangs a parrot
5713ok 821 # SKIP [re_tests:821] hangs a parrot
5714ok 822 # SKIP [re_tests:822] hangs a parrot
5715ok 823 # SKIP [re_tests:823] hangs a parrot
5716not ok 827 # TODO [re_tests:827] \d in character class
5717ok 828 # SKIP [re_tests:828]
5718ok 829 # SKIP [re_tests:829]
5719ok 830 # SKIP [re_tests:830]
5720ok 834 # SKIP [re_tests:834]
5721ok 835 # SKIP [re_tests:835]
5722ok 836 # SKIP [re_tests:836]
5723ok 838 # SKIP [re_tests:838]
5724not ok 858 # TODO [re_tests:858] unknown reason
5725ok 859 # SKIP [re_tests:859]
5726ok 862 # SKIP [re_tests:862]
5727not ok 865 # TODO [re_tests:865] unknown reason
5728not ok 866 # TODO [re_tests:866] unknown reason
5729ok 877 # SKIP [re_tests:877]
5730ok 879 # SKIP [re_tests:879] [ID 20010811.006]
5731not ok 881 # TODO [re_tests:881] unknown reason
5732ok 886 # SKIP [re_tests:886]
5733not ok 887 # TODO [re_tests:887] unknown reason
5734not ok 888 # TODO [re_tests:888] unknown reason
5735not ok 890 # TODO [re_tests:890] unknown reason
5736not ok 891 # TODO [re_tests:891] unknown reason
5737not ok 893 # TODO [re_tests:893] unknown reason
5738not ok 896 # TODO [re_tests:896] unknown reason
5739not ok 897 # TODO [re_tests:897] unknown reason
5740not ok 898 # TODO [re_tests:898] unknown reason
5741not ok 899 # TODO [re_tests:899] unknown reason
5742not ok 901 # TODO [re_tests:901] greediness/lookbehind
5743not ok 904 # TODO [re_tests:904] greediness/lookbehind
5744not ok 905 # TODO [re_tests:905] greediness/lookbehind
5745not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion
5746not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion
5747not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion
5748not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion
5749not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion
5750not ok 915 # TODO [re_tests:915] non-greedy/lookbehind
5751not ok 916 # TODO [re_tests:916] non-greedy/lookbehind
5752not ok 918 # TODO [re_tests:918] non-greedy/lookbehind
5753not ok 921 # TODO [re_tests:921] non-greedy/lookbehind
5754not ok 922 # TODO [re_tests:922] non-greedy/lookbehind
5755not ok 923 # TODO [re_tests:923] unmatched bracket
5756ok 924 # SKIP [re_tests:924]
5757ok 926 # SKIP [re_tests:926] [perl #18019]
5758not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171]
5759not ok 928 # TODO [re_tests:928] reuse captured group
5760not ok 929 # TODO [re_tests:929] reuse captured group
5761not ok 930 # TODO [re_tests:930] reuse captured group
5762not ok 931 # TODO [re_tests:931] reuse captured group
5763not ok 932 # TODO [re_tests:932] reuse captured group
5764not ok 933 # TODO [re_tests:933] reuse captured group
5765not ok 934 # TODO [re_tests:934] reuse captured group
5766not ok 935 # TODO [re_tests:935] reuse captured group
5767not ok 936 # TODO [re_tests:936] reuse captured group
5768not ok 937 # TODO [re_tests:937] reuse captured group
5769not ok 938 # TODO [re_tests:938] reuse captured group
5770not ok 939 # TODO [re_tests:939] reuse captured group
5771not ok 940 # TODO [re_tests:940] reuse captured group
5772not ok 941 # TODO [re_tests:941] reuse captured group
5773not ok 942 # TODO [re_tests:942] reuse captured group
5774ok 944 # SKIP [re_tests:944] unknown reason
5775ok 945 # SKIP [re_tests:945] unknown reason
5776ok 957 # SKIP [re_tests:957]
5777ok 958 # SKIP [re_tests:958]
5778not ok 959 # TODO [re_tests:959] [perl #34195]
5779not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion
5780ok
5781t/compilers/pge/perl6regex/01-regex....
5782not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&|) - parse error
5783not ok 99 # TODO [rx_metachars:114] null pattern invalid
5784not ok 386 # TODO [rx_backtrack:4] basic
5785not ok 427 # TODO [rx_charclass:26] illegal character range
5786not ok 458 # TODO [rx_charclass:62] literal match (\")
5787not ok 459 # TODO [rx_charclass:64] literal match (\")
5788not ok 460 # TODO [rx_charclass:66] literal match with quote
5789not ok 461 # TODO [rx_charclass:68] literal match with quote
5790not ok 462 # TODO [rx_charclass:70] literal match with backslash
5791not ok 463 # TODO [rx_charclass:72] literal match with interpolation
5792not ok 464 # TODO [rx_charclass:74] literal match with interpolation
5793not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i)
5794not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s)
5795not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s)
5796not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s)
5797not ok 709 # TODO [rx_modifiers:131] basic ws match
5798not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5)
5799not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth)
5800not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth)
5801ok
5802t/compilers/pge/perl6regex/context.....
5803not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented
5804ok
5805t/compilers/tge/basic..................ok
5806t/compilers/tge/grammar................
5807not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug
5808ok
5809t/compilers/tge/parser.................ok
5810t/library/cgi_query_hash...............ok
5811t/library/coroutine....................ok
5812t/library/dumper.......................ok
5813t/library/getopt_obj...................ok
5814t/library/hllmacros....................ok
5815t/library/iter.........................ok
5816t/library/md5..........................ok
5817t/library/mime_base64..................ok
5818t/library/mt19937ar....................ok
5819t/library/p6object.....................
5820not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) >
5821ok
5822t/library/parrotlib....................ok
5823t/library/pcre.........................
5824ok 1 # SKIP no pcre-config
5825ok
5826t/library/pg...........................
5827ok 1 # SKIP skipped
5828ok 2 # SKIP skipped
5829ok 3 # SKIP skipped
5830ok 4 # SKIP skipped
5831ok 5 # SKIP skipped
5832ok 6 # SKIP skipped
5833ok 7 # SKIP skipped
5834ok 8 # SKIP skipped
5835ok 9 # SKIP skipped
5836ok 10 # SKIP skipped
5837ok 11 # SKIP skipped
5838ok 12 # SKIP skipped
5839ok 13 # SKIP skipped
5840ok 14 # SKIP skipped
5841ok 15 # SKIP skipped
5842ok 16 # SKIP skipped
5843ok 17 # SKIP skipped
5844ok 18 # SKIP skipped
5845ok 19 # SKIP skipped
5846ok 20 # SKIP skipped
5847ok 21 # SKIP skipped
5848ok 22 # SKIP skipped
5849ok 23 # SKIP skipped
5850ok 24 # SKIP skipped
5851ok 25 # SKIP skipped
5852ok 26 # SKIP skipped
5853ok 27 # SKIP skipped
5854ok 28 # SKIP skipped
5855ok 29 # SKIP skipped
5856ok 30 # SKIP skipped
5857ok 31 # SKIP skipped
5858ok 32 # SKIP skipped
5859ok 33 # SKIP skipped
5860ok 34 # SKIP skipped
5861ok 35 # SKIP skipped
5862ok 36 # SKIP skipped
5863ok 37 # SKIP skipped
5864ok 38 # SKIP skipped
5865ok 39 # SKIP skipped
5866ok 40 # SKIP skipped
5867ok 41 # SKIP skipped
5868ok 42 # SKIP skipped
5869ok 43 # SKIP skipped
5870ok
5871t/library/protoobject..................ok
5872t/library/rand.........................ok
5873t/library/range........................ok
5874t/library/streams......................
5875ok 18 # SKIP broken method invocation
5876ok 20 # SKIP broken method invocation
5877ok
5878t/library/string_utils.................ok
5879t/library/tcl_glob.....................ok
5880t/library/tcl_lib......................ok
5881t/library/test_builder_tester..........ok
5882t/library/test_class...................ok
5883t/library/test_more....................ok
5884t/library/uuid.........................ok
5885t/library/yaml_dumper..................
5886not ok 7 - properties # TODO not yet implemented
5887not ok 8 - indent string # TODO not supported
5888not ok 9 - back-referencing properties # TODO not yet implemented
5889not ok 10 - self-referential properties (1) # TODO not yet implemented
5890not ok 11 - self-referential properties (2) # TODO not yet implemented
5891not ok 26 - custom dumper # TODO not yet implemented
5892ok
5893t/library/yaml_parser_syck.............
5894not ok 1 - basic parsing # TODO Not properly implemented yet
5895ok
5896
5897Test Summary Report
5898-------------------
5899t/op/trans                         (Wstat: 0 Tests: 22 Failed: 0)
5900  TODO passed:   13
5901t/compilers/pge/pge_examples       (Wstat: 256 Tests: 2 Failed: 1)
5902  Failed test:  2
5903  Non-zero exit status: 1
5904Files=252, Tests=8027, 469 wallclock secs ( 6.01 usr  4.01 sys + 187.71 cusr 103.45 csys = 301.18 CPU)
5905Result: FAIL
5906make[1]: *** [testj] Error 1
5907make: [fulltest] Error 2 (ignored)