make testb \ testC \ testf \ testg \ testj \ testr \ testS \ src_tests \ run_tests \ perl_tests \ codetest \ benchmark_tests \ manifest_tests \ examples_tests \ distro_tests Compiling with: xx.c cc -I./include -g -pipe -fno-common -no-cpp-precomp -Wdeclaration-after-statement -I/usr/local/include -pipe -fno-common -Wno-long-double -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wbad-function-cast -Wdeclaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -g -Wno-shadow -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO -I. -o xx.o -c xx.c make -C docs perl -MExtUtils::Command -e mkpath ops make -C src/dynpmc perl -MExtUtils::Command -e cp *.bundle /Users/leto/svn/parrot/runtime/parrot/dynext make -C src/dynoplibs perl -MExtUtils::Command -e cp *.bundle /Users/leto/svn/parrot/runtime/parrot/dynext make -C compilers/pct make[2]: Nothing to be done for `all'. make -C compilers/pge make[2]: Nothing to be done for `all'. make -C compilers/tge make[2]: Nothing to be done for `all'. make -C compilers/nqp make[2]: Nothing to be done for `all'. make -C compilers/json make[2]: Nothing to be done for `all'. perl t/harness --gc-debug --running-make-test -b --runcore-tests t/compilers/imcc/imcpasm/cfg...........ok t/compilers/imcc/imcpasm/opt0.......... ok 1 # SKIP disabled graph coloring register allocator, RT #57028 ok 3 # SKIP disabled graph coloring register allocator, RT #57028 ok t/compilers/imcc/imcpasm/opt1.......... ok 76 # SKIP constant concat N/Y ok t/compilers/imcc/imcpasm/opt2.......... ok 5 # SKIP loop opt disabled for now ok t/compilers/imcc/imcpasm/optc.......... not ok 9 - tailcall 1 # TODO RT #57028 ok t/compilers/imcc/imcpasm/pcc...........ok t/compilers/imcc/imcpasm/sub...........ok t/compilers/imcc/reg/alloc.............ok t/compilers/imcc/reg/spill.............ok t/compilers/imcc/syn/bsr...............ok t/compilers/imcc/syn/clash............. not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet ok t/compilers/imcc/syn/const.............ok t/compilers/imcc/syn/errors............ok t/compilers/imcc/syn/eval.............. ok 1 # SKIP changed eval semantics - see t/pmc/eval.t ok 2 # SKIP changed eval semantics - see t/pmc/eval.t ok 3 # SKIP changed eval semantics - see t/pmc/eval.t ok 4 # SKIP changed eval semantics - see t/pmc/eval.t ok 5 # SKIP changed eval semantics - see t/pmc/eval.t ok 6 # SKIP changed eval semantics - see t/pmc/eval.t ok 7 # SKIP changed eval semantics - see t/pmc/eval.t ok t/compilers/imcc/syn/file.............. ok 13 # SKIP multiple loading not speced - failing ok t/compilers/imcc/syn/hll...............ok t/compilers/imcc/syn/keyed............. ok 1 # SKIP experimental ok t/compilers/imcc/syn/labels............ok t/compilers/imcc/syn/macro............. not ok 25 - unterminated macro 2 # TODO Darwin segfault -- RT #60926 ok t/compilers/imcc/syn/objects...........ok t/compilers/imcc/syn/op................ok t/compilers/imcc/syn/pasm..............ok t/compilers/imcc/syn/pcc...............ok t/compilers/imcc/syn/pod............... ok 4 # SKIP Closing out of pod from included files ok t/compilers/imcc/syn/regressions....... not ok 4 - comments between .param(RT \#46499) # TODO broken not ok 6 - whitespace between .param(RT \#46499) # TODO broken not ok 7 - off by one error message (RT \#40204) # TODO broken ok t/compilers/imcc/syn/scope.............ok t/compilers/imcc/syn/subflags.......... not ok 15 # TODO :method sub not found in namespace ok t/compilers/imcc/syn/symbols...........ok t/compilers/imcc/syn/tail..............ok t/compilers/imcc/syn/veracity..........ok t/op/00ff-dos..........................ok t/op/00ff-unix.........................ok t/op/01-parse_ops......................ok t/op/64bit............................. 1..0 # Skip 64bit INTVAL platforms only skipped: 64bit INTVAL platforms only t/op/annotate..........................ok t/op/arithmetics....................... ok 28 # SKIP No integer overflow for 32-bit INTVALs without GMP installed ok t/op/basic.............................ok t/op/bitwise........................... ok 27 # SKIP no BigInt lib found ok t/op/box...............................ok t/op/calling........................... not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all not ok 93 - arg mismatch with no params # TODO RT #39844 ok t/op/cc_params.........................ok t/op/cc_state.......................... not ok 6 - positional found, named expected # TODO cc processor state missing not ok 8 - G2: argument underflow: required slurpy param # TODO failing ok t/op/cmp-nonbranch.....................ok t/op/comp..............................ok t/op/copy..............................ok t/op/debuginfo.........................ok t/op/exceptions........................ not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans ok t/op/gc................................ok t/op/globals...........................ok t/op/hacks............................. ok 1 # SKIP no universal SIGFPE handling ok 2 # SKIP no universal SIGFPE handling ok t/op/ifunless..........................ok t/op/integer...........................ok t/op/interp............................ ok 1 # SKIP we really shouldn't run just a label - use a sub ok t/op/io................................ok t/op/jit...............................ok t/op/jitn..............................ok t/op/lexicals.......................... not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented ok t/op/literal...........................ok t/op/load_bytecode.....................ok t/op/number............................ok t/op/pushaction........................ not ok 7 - pushaction: error while handling error # TODO runloop shenanigans ok t/op/say...............................ok t/op/spawnw............................ok t/op/sprintf........................... ok 5 # SKIP parrot extension (%B) ok 7 # SKIP perl5-specific extension (%D) ok 9 # SKIP perl5-specific extension (%F) ok 16 # SKIP parrot extension (%H) ok 20 # SKIP parrot extension (%L) ok 23 # SKIP perl5-specific extension (%O) ok 24 # SKIP parrot extension (%P) ok 27 # SKIP parrot extension (%S) ok 29 # SKIP perl5-specific extension (%U) not ok 64 # TODO [%03.2d] actual: > 01< ok 71 # SKIP perl5-specific extension (%v...) ok 72 # SKIP perl5-specific extension (%v...) ok 73 # SKIP perl5-specific extension (%v...) ok 74 # SKIP perl5-specific extension (%v...) ok 75 # SKIP perl5-specific extension (%v...) ok 76 # SKIP perl5-specific extension (%v...) ok 77 # SKIP perl5-specific extension (%v...) ok 78 # SKIP perl5-specific extension (%v...) ok 79 # SKIP perl5-specific extension (%v...) ok 80 # SKIP perl5-specific extension (%v...) ok 81 # SKIP perl5-specific extension (%v...) ok 82 # SKIP perl5-specific extension (%v...) ok 83 # SKIP perl5-specific extension (%v...) ok 84 # SKIP perl5-specific extension (%v...) ok 85 # SKIP perl5-specific extension (%v...) ok 86 # SKIP perl5-specific extension (%v...) ok 87 # SKIP perl5-specific extension (%v...) ok 88 # SKIP perl5-specific extension (%v...) ok 89 # SKIP perl5-specific extension (%v...) ok 90 # SKIP perl5-specific extension (%v...) ok 91 # SKIP perl5-specific extension (%v...) ok 92 # SKIP perl5-specific extension (%v...) ok 93 # SKIP perl5-specific extension (%v...) ok 94 # SKIP perl5-specific extension (%v...) ok 95 # SKIP perl5-specific extension (%v...) ok 96 # SKIP perl5-specific extension (%v...) ok 97 # SKIP perl5-specific extension (%v...) ok 98 # SKIP perl5-specific extension (%v...) ok 99 # SKIP perl5-specific extension (%v...) ok 114 # SKIP harness needs support for * modifier ok 131 # SKIP harness needs support for * modifier ok 141 # SKIP harness needs support for * modifier ok 144 # SKIP perl5 expresssion as test value not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1< ok 161 # SKIP harness needs support for * modifier ok 166 # SKIP harness needs support for * modifier not ok 187 # TODO [%h] actual: >< not ok 191 # TODO [%l] actual: >< ok 193 # SKIP perl5-specific test ok 200 # SKIP perl5-specific test ok 201 # SKIP perl5-specific test ok 202 # SKIP parrot extension (%p) ok 204 # SKIP parrot extension (%r) ok 210 # SKIP harness needs support for * modifier ok 214 # SKIP harness needs support for * modifier not ok 223 # TODO [%v] actual: >< ok 233 # SKIP harness needs support for * modifier ok 234 # SKIP perl5-specific extension (%v...) ok 235 # SKIP perl5-specific extension (%v...) ok 238 # SKIP perl5-specific test ok 239 # SKIP perl5-specific test ok 240 # SKIP perl5-specific test ok 241 # SKIP perl5-specific test ok 242 # SKIP perl5-specific test ok 243 # SKIP perl5-specific test ok 244 # SKIP perl5-specific test ok 245 # SKIP perl5-specific test ok 246 # SKIP perl5-specific test ok 247 # SKIP perl5-specific test ok 248 # SKIP perl5-specific test ok 249 # SKIP perl5-specific test ok 250 # SKIP perl5-specific test ok 251 # SKIP perl5-specific test ok 252 # SKIP perl5-specific extension (%v...) ok 253 # SKIP perl5-specific extension (%v...) ok 254 # SKIP perl5-specific extension (%v...) ok 255 # SKIP perl5-specific extension (%v...) ok 256 # SKIP perl5-specific extension (%v...) ok 257 # SKIP perl5-specific extension (%v...) ok 258 # SKIP perl5-specific extension (%v...) ok 259 # SKIP perl5-specific extension (%v...) ok 260 # SKIP perl5-specific extension (%v...) ok 261 # SKIP perl5-specific extension (%v...) ok 262 # SKIP perl5-specific extension (%v...) ok 263 # SKIP perl5-specific extension (%v...) ok 264 # SKIP perl5-specific extension (%v...) ok 265 # SKIP perl5-specific extension (%v...) ok 266 # SKIP perl5-specific extension (%v...) ok 267 # SKIP perl5-specific extension (%v...) ok 268 # SKIP perl5-specific extension (%v...) ok 269 # SKIP perl5-specific extension (%v...) ok 270 # SKIP perl5-specific extension (%v...) ok 271 # SKIP perl5-specific extension (%v...) ok 272 # SKIP perl5-specific extension (%v...) ok 273 # SKIP perl5-specific extension (%v...) ok 274 # SKIP perl5-specific extension (%v...) ok 275 # SKIP perl5-specific extension (%v...) ok 276 # SKIP perl5-specific extension (%v...) ok 277 # SKIP perl5-specific extension (%v...) ok 278 # SKIP perl5-specific extension (%v...) ok 279 # SKIP perl5-specific extension (%v...) ok 280 # SKIP perl5-specific extension (%v...) ok 281 # SKIP perl5-specific extension (%v...) ok 282 # SKIP perl5-specific extension (%v...) ok 283 # SKIP perl5-specific extension (%v...) ok 284 # SKIP perl5-specific extension (%v...) ok 285 # SKIP perl5-specific extension (%v...) ok 286 # SKIP perl5-specific extension (%v...) ok 287 # SKIP perl5-specific extension (%v...) ok 288 # SKIP perl5-specific extension (%v...) ok 289 # SKIP perl5-specific extension (%v...) ok 290 # SKIP perl5-specific extension (%v...) ok 291 # SKIP perl5-specific extension (%v...) ok 292 # SKIP perl5-specific extension (%v...) ok 293 # SKIP perl5-specific extension (%v...) ok 294 # SKIP perl5-specific extension (%v...) ok 295 # SKIP perl5-specific extension (%v...) ok 296 # SKIP perl5-specific extension (%v...) ok 297 # SKIP perl5-specific extension (%v...) ok 298 # SKIP perl5-specific extension (%v...) ok 300 # SKIP harness needs support for * modifier not ok 304 # TODO [%#b] actual: >0b0< not ok 305 # TODO [%#o] actual: >00< not ok 306 # TODO [%#x] actual: >0x0< ok 307 # SKIP perl5-specific extension (%v...) ok 308 # SKIP perl5-specific extension (%v...) ok t/op/sprintf2..........................ok t/op/string............................ ok 103 # SKIP Pending rework of creating non-ascii literals ok 104 # SKIP Pending rework of creating non-ascii literals ok 118 # SKIP Pending reimplementation of find_encoding ok 119 # SKIP no more visible encoding ok 137 # SKIP No unicode yet ok 139 # SKIP no more transcode ok 140 # SKIP no more chartype ok t/op/string_cclass..................... ok 7 # SKIP unicode support unavailable ok 8 # SKIP unicode support unavailable ok 9 # SKIP unicode support unavailable ok t/op/string_cs......................... ok 31 # SKIP no ICU lib ok 32 # SKIP no ICU lib ok 33 # SKIP no ICU lib ok 34 # SKIP no ICU lib ok 35 # SKIP no ICU lib ok 36 # SKIP no ICU lib ok 37 # SKIP no ICU lib ok 38 # SKIP no ICU lib ok 39 # SKIP no ICU lib ok 40 # SKIP no ICU lib ok 41 # SKIP no ICU lib ok 42 # SKIP no ICU lib ok 43 # SKIP no ICU lib ok 44 # SKIP no ICU lib ok 45 # SKIP no ICU lib ok 46 # SKIP no ICU lib ok t/op/string_mem........................ok t/op/stringu........................... ok 20 # SKIP no ICU lib ok 21 # SKIP no ICU lib ok 22 # SKIP no ICU lib ok 25 # SKIP Tests seem to fail on big endian machines with icu ok 26 # SKIP Tests seem to fail on big endian machines with icu not ok 27 - UTF-8 and Unicode literals # TODO TT #24 ok t/op/sysinfo........................... not ok 11 - sysinfo OS version string # TODO Not Currently Implemented not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented ok 13 # SKIP Requires a lot of work to find out the correct answer ok 14 # SKIP Testing only in some known platforms ok t/op/time..............................ok t/op/trans.............................ok t/pmc/addrregistry.....................ok t/pmc/array............................ not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken ok t/pmc/bigint........................... 1..0 # Skip No BigInt Lib configured skipped: No BigInt Lib configured t/pmc/bignum........................... 1..0 # Skip No BigNum PMC enabled skipped: No BigNum PMC enabled t/pmc/boolean..........................ok t/pmc/bound_nci........................ok t/pmc/callsignature....................ok t/pmc/capture..........................ok t/pmc/class............................ not ok 28 # TODO add_method() invoking method added to class works ok t/pmc/codestring.......................ok t/pmc/complex.......................... ok 58 # SKIP div by zero not caught ok 59 # SKIP div by zero not caught ok 60 # SKIP div by zero not caught ok 86 # SKIP instantiate n/y ok 87 # SKIP instantiate n/y ok 88 # SKIP instantiate n/y ok 89 # SKIP instantiate n/y ok 126 # SKIP inf is not platform-independent ok 465 # SKIP add using subclass of Complex - RT #59630 ok 466 # SKIP add using subclass of Complex - RT #59630 ok 467 # SKIP add using subclass of Complex - RT #59630 ok t/pmc/config...........................ok t/pmc/continuation.....................ok t/pmc/coroutine........................ not ok 9 - Call an exited coroutine # TODO goes one iteration too far. ok t/pmc/cpointer.........................ok t/pmc/default.......................... not ok 1 - new # TODO not implemeted ok t/pmc/env..............................ok t/pmc/eval.............................ok t/pmc/eventhandler.....................ok t/pmc/exception........................ not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans not ok 25 - pushaction: error while handling error # TODO runloop shenanigans not ok 27 - invoke handler in calling sub # TODO deprecate rethrow not ok 30 - catch ex from C-level MULTI function # TODO broken ok t/pmc/exceptionhandler.................ok t/pmc/exporter.........................ok t/pmc/file.............................ok t/pmc/filehandle....................... ok 3 # SKIP no asynch calls yet not ok 8 - record_separator # TODO not yet implemented ok t/pmc/fixedbooleanarray................ok t/pmc/fixedfloatarray..................ok t/pmc/fixedintegerarray................ok t/pmc/fixedpmcarray....................ok t/pmc/fixedstringarray.................ok t/pmc/float............................ok t/pmc/freeze...........................ok t/pmc/globals..........................ok t/pmc/hash.............................ok t/pmc/integer..........................ok t/pmc/io............................... not ok 1 - IO on some invalid types # TODO IO on some invalid types ok 8 # SKIP clone not finished yet not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433 not ok 40 - string read/write handle # TODO no stringhandle yet ok t/pmc/io_iterator...................... not ok 1 - new # TODO not yet implemented not ok 2 - shift # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented ok t/pmc/io_status........................ not ok 1 - new # TODO not yet implemented not ok 2 - get_integer (vtable) # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented not ok 4 - return # TODO not yet implemented not ok 5 - error # TODO not yet implemented not ok 6 - throw # TODO not yet implemented ok t/pmc/iterator......................... ok 13 # SKIP N/Y: length of rest of array not ok 16 - adding keys during iteration # TODO adding keys during iteration not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points' ok t/pmc/key.............................. not ok 10 # TODO register and non-register string keys should be COW (RT #60128) ok t/pmc/lexinfo..........................ok t/pmc/lexpad...........................ok t/pmc/managedstruct....................ok t/pmc/multidispatch.................... not ok 22 - MMD on PMC types - Any # TODO RT #41374 not ok 25 - add as method - inherited # TODO RT #41374 not ok 32 - use a core func for an object # TODO RT #59628 ok t/pmc/multisub.........................ok t/pmc/namespace........................ not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17 ok t/pmc/nci..............................ok t/pmc/null.............................ok t/pmc/object-meths..................... ok 14 # SKIP currently broken ok 25 # SKIP no bound NCI method ok t/pmc/object-mro.......................ok t/pmc/object...........................ok t/pmc/objects..........................ok t/pmc/orderedhash......................ok t/pmc/os...............................ok t/pmc/packfile.........................ok t/pmc/packfileconstanttable............ not ok 3 - get_type, get_*_keyed_int # TODO See TT #385. ok t/pmc/packfiledirectory................ok t/pmc/packfilefixupentry...............ok t/pmc/packfilefixuptable...............ok t/pmc/packfilerawsegment...............ok t/pmc/packfilesegment..................ok t/pmc/parrotclass......................ok t/pmc/parrotinterpreter................ok t/pmc/parrotio......................... not ok 2 - open and close - synchronous # TODO not yet implemented ok 3 # SKIP no asynch calls yet not ok 4 - print, read, and readline - synchronous # TODO not yet implemented not ok 5 - record_separator # TODO not yet implemented not ok 6 - buffer_type # TODO not yet implemented ok t/pmc/parrotlibrary....................ok t/pmc/parrotobject.....................ok t/pmc/parrotrunningthread..............ok t/pmc/parrotthread.....................ok t/pmc/pccmethod_test...................ok t/pmc/pmc..............................ok t/pmc/pmcproxy.........................ok t/pmc/pointer..........................ok t/pmc/prop.............................ok t/pmc/random...........................ok t/pmc/ref..............................ok t/pmc/resizablebooleanarray............ok t/pmc/resizablefloatarray..............ok t/pmc/resizableintegerarray............ok t/pmc/resizablepmcarray................ok t/pmc/resizablestringarray.............ok t/pmc/retcontinuation..................ok t/pmc/ro............................... not ok 8 - ResizablePMCArray -- Recursive # TODO 1 ok t/pmc/role.............................ok t/pmc/scalar........................... ok 1 # SKIP doesn't work yet ok t/pmc/scheduler........................ok t/pmc/schedulermessage.................ok t/pmc/sharedref........................ok t/pmc/signal........................... 1..0 # Skip Signals currently disabled skipped: Signals currently disabled t/pmc/slice............................ not ok 2 - bug with slice bits # TODO parser ok t/pmc/string...........................ok t/pmc/stringhandle..................... ok 3 # SKIP no asynch calls yet not ok 9 - record_separator # TODO not yet implemented ok t/pmc/sub..............................ok t/pmc/sys..............................ok t/pmc/task.............................ok t/pmc/threads.......................... not ok 11 - CLONE_CODE | CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511 not ok 15 - CLONE_CODE|CLONE_GLOBALS|CLONE_HLL|CLONE_LIBRARIES # TODO RT #41373 ok t/pmc/timer............................ok t/pmc/undef............................ok t/pmc/unmanagedstruct..................ok t/oo/attributes........................ok t/oo/composition.......................ok t/oo/inheritance.......................ok t/oo/isa...............................ok t/oo/metamodel......................... not ok 6 # TODO tail attribute has a type not ok 12 # TODO new opcode makes working objects ok t/oo/methods...........................ok t/oo/mro-c3............................ok t/oo/names.............................ok t/oo/new...............................ok t/oo/ops...............................ok t/oo/proxy.............................ok t/oo/subclass..........................ok t/oo/vtableoverride....................ok t/native_pbc/header.................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/native_pbc/integer................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/native_pbc/number.................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/native_pbc/string.................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/dynpmc/dynlexpad..................... not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads ok t/dynpmc/foo........................... ok 6 # SKIP No BigInt Lib configured ok t/dynpmc/gdbmhash...................... 1..0 # Skip No gdbm library available skipped: No gdbm library available t/dynpmc/md2...........................ok t/dynpmc/md4...........................ok t/dynpmc/md5...........................ok t/dynpmc/pair..........................ok t/dynpmc/rational......................ok t/dynpmc/ripemd160.....................ok t/dynpmc/rotest........................ok t/dynpmc/sha...........................ok t/dynpmc/sha1..........................ok t/dynpmc/sha256........................ 1..0 # Skip Too old library skipped: Too old library t/dynpmc/sha512........................ 1..0 # Skip Too old library skipped: Too old library t/dynpmc/subclass_with_pir_method...... not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces ok t/dynpmc/subproxy......................ok t/dynoplibs/dan........................ok t/dynoplibs/myops......................ok t/compilers/pct/complete_workflow......ok t/compilers/pct/past...................ok t/compilers/pct/pct_hllcompiler........ok t/compilers/pct/post...................ok t/compilers/pge/00-basic...............ok t/compilers/pge/02-match...............ok t/compilers/pge/03-optable.............ok t/compilers/pge/04-compile.............ok t/compilers/pge/06-grammar.............ok t/compilers/pge/pge-hs.................ok t/compilers/pge/pge....................ok t/compilers/pge/pge_examples...........ok t/compilers/pge/pge_globs..............ok t/compilers/pge/pge_text...............ok t/compilers/pge/pge_util...............ok t/compilers/pge/p5regex/p5rx........... not ok 116 # TODO [re_tests:116] character class in enumeration not ok 119 # TODO [re_tests:119] character class in enumeration not ok 120 # TODO [re_tests:120] character class in enumeration not ok 123 # TODO [re_tests:123] character class in enumeration not ok 124 # TODO [re_tests:124] character class in enumeration not ok 127 # TODO [re_tests:127] character class in enumeration ok 138 # SKIP [re_tests:138] parser bug ok 139 # SKIP [re_tests:139] broken col 4? ok 143 # SKIP [re_tests:143] bug or error ok 144 # SKIP [re_tests:144] bug or error ok 148 # SKIP [re_tests:148] bug or error ok 149 # SKIP [re_tests:149] bug or error ok 155 # SKIP [re_tests:155] bug or error ok 167 # SKIP [re_tests:167] bug or error not ok 234 # TODO [re_tests:234] unknown reason not ok 235 # TODO [re_tests:235] unknown reason not ok 236 # TODO [re_tests:236] unknown reason not ok 246 # TODO [re_tests:246] unknown reason not ok 247 # TODO [re_tests:247] unknown reason ok 248 # SKIP [re_tests:248] bug or error ok 249 # SKIP [re_tests:249] bug or error ok 252 # SKIP [re_tests:252] bug or error not ok 254 # TODO [re_tests:254] unknown reason not ok 256 # TODO [re_tests:256] unknown reason not ok 257 # TODO [re_tests:257] unknown reason ok 264 # SKIP [re_tests:264] trailing modifiers ok 265 # SKIP [re_tests:265] trailing modifiers ok 266 # SKIP [re_tests:266] trailing modifiers ok 267 # SKIP [re_tests:267] trailing modifiers ok 268 # SKIP [re_tests:268] trailing modifiers ok 269 # SKIP [re_tests:269] trailing modifiers ok 270 # SKIP [re_tests:270] trailing modifiers ok 271 # SKIP [re_tests:271] trailing modifiers ok 272 # SKIP [re_tests:272] trailing modifiers ok 273 # SKIP [re_tests:273] trailing modifiers ok 274 # SKIP [re_tests:274] trailing modifiers ok 275 # SKIP [re_tests:275] trailing modifiers ok 276 # SKIP [re_tests:276] trailing modifiers ok 277 # SKIP [re_tests:277] trailing modifiers ok 278 # SKIP [re_tests:278] trailing modifiers ok 279 # SKIP [re_tests:279] trailing modifiers ok 280 # SKIP [re_tests:280] trailing modifiers ok 281 # SKIP [re_tests:281] trailing modifiers ok 282 # SKIP [re_tests:282] trailing modifiers ok 283 # SKIP [re_tests:283] trailing modifiers ok 284 # SKIP [re_tests:284] trailing modifiers ok 285 # SKIP [re_tests:285] trailing modifiers ok 286 # SKIP [re_tests:286] trailing modifiers ok 287 # SKIP [re_tests:287] trailing modifiers ok 288 # SKIP [re_tests:288] trailing modifiers ok 289 # SKIP [re_tests:289] trailing modifiers ok 290 # SKIP [re_tests:290] trailing modifiers ok 291 # SKIP [re_tests:291] trailing modifiers ok 292 # SKIP [re_tests:292] trailing modifiers ok 293 # SKIP [re_tests:293] trailing modifiers ok 294 # SKIP [re_tests:294] trailing modifiers ok 295 # SKIP [re_tests:295] trailing modifiers ok 296 # SKIP [re_tests:296] trailing modifiers ok 297 # SKIP [re_tests:297] trailing modifiers ok 298 # SKIP [re_tests:298] trailing modifiers ok 299 # SKIP [re_tests:299] trailing modifiers ok 300 # SKIP [re_tests:300] trailing modifiers ok 301 # SKIP [re_tests:301] trailing modifiers ok 302 # SKIP [re_tests:302] trailing modifiers ok 303 # SKIP [re_tests:303] trailing modifiers ok 304 # SKIP [re_tests:304] trailing modifiers ok 305 # SKIP [re_tests:305] trailing modifiers ok 306 # SKIP [re_tests:306] trailing modifiers ok 307 # SKIP [re_tests:307] trailing modifiers ok 308 # SKIP [re_tests:308] bug or error ok 309 # SKIP [re_tests:309] bug or error ok 310 # SKIP [re_tests:310] bug or error ok 311 # SKIP [re_tests:311] trailing modifiers ok 312 # SKIP [re_tests:312] trailing modifiers ok 313 # SKIP [re_tests:313] trailing modifiers ok 314 # SKIP [re_tests:314] trailing modifiers ok 315 # SKIP [re_tests:315] trailing modifiers ok 316 # SKIP [re_tests:316] trailing modifiers ok 317 # SKIP [re_tests:317] trailing modifiers ok 318 # SKIP [re_tests:318] trailing modifiers ok 319 # SKIP [re_tests:319] trailing modifiers ok 320 # SKIP [re_tests:320] trailing modifiers ok 321 # SKIP [re_tests:321] trailing modifiers ok 322 # SKIP [re_tests:322] bug or error ok 323 # SKIP [re_tests:323] bug or error ok 324 # SKIP [re_tests:324] trailing modifiers ok 325 # SKIP [re_tests:325] bug or error ok 326 # SKIP [re_tests:326] trailing modifiers ok 327 # SKIP [re_tests:327] trailing modifiers ok 328 # SKIP [re_tests:328] trailing modifiers ok 329 # SKIP [re_tests:329] trailing modifiers ok 330 # SKIP [re_tests:330] bug or error ok 331 # SKIP [re_tests:331] bug or error ok 332 # SKIP [re_tests:332] trailing modifiers ok 333 # SKIP [re_tests:333] trailing modifiers ok 334 # SKIP [re_tests:334] trailing modifiers ok 335 # SKIP [re_tests:335] trailing modifiers ok 336 # SKIP [re_tests:336] bug or error ok 337 # SKIP [re_tests:337] trailing modifiers ok 338 # SKIP [re_tests:338] trailing modifiers ok 339 # SKIP [re_tests:339] trailing modifiers ok 340 # SKIP [re_tests:340] trailing modifiers ok 341 # SKIP [re_tests:341] trailing modifiers ok 342 # SKIP [re_tests:342] trailing modifiers ok 343 # SKIP [re_tests:343] trailing modifiers ok 344 # SKIP [re_tests:344] trailing modifiers ok 345 # SKIP [re_tests:345] trailing modifiers ok 346 # SKIP [re_tests:346] trailing modifiers ok 347 # SKIP [re_tests:347] bug or error ok 348 # SKIP [re_tests:348] trailing modifiers ok 349 # SKIP [re_tests:349] trailing modifiers ok 350 # SKIP [re_tests:350] trailing modifiers ok 351 # SKIP [re_tests:351] trailing modifiers ok 352 # SKIP [re_tests:352] trailing modifiers ok 353 # SKIP [re_tests:353] trailing modifiers ok 354 # SKIP [re_tests:354] trailing modifiers ok 355 # SKIP [re_tests:355] trailing modifiers ok 356 # SKIP [re_tests:356] trailing modifiers ok 357 # SKIP [re_tests:357] trailing modifiers ok 358 # SKIP [re_tests:358] trailing modifiers ok 359 # SKIP [re_tests:359] trailing modifiers ok 360 # SKIP [re_tests:360] trailing modifiers ok 361 # SKIP [re_tests:361] trailing modifiers ok 362 # SKIP [re_tests:362] trailing modifiers ok 363 # SKIP [re_tests:363] trailing modifiers ok 364 # SKIP [re_tests:364] trailing modifiers ok 365 # SKIP [re_tests:365] trailing modifiers ok 366 # SKIP [re_tests:366] trailing modifiers ok 367 # SKIP [re_tests:367] trailing modifiers ok 368 # SKIP [re_tests:368] trailing modifiers ok 369 # SKIP [re_tests:369] trailing modifiers ok 370 # SKIP [re_tests:370] trailing modifiers ok 371 # SKIP [re_tests:371] trailing modifiers ok 372 # SKIP [re_tests:372] trailing modifiers ok 373 # SKIP [re_tests:373] trailing modifiers ok 374 # SKIP [re_tests:374] trailing modifiers ok 375 # SKIP [re_tests:375] trailing modifiers ok 376 # SKIP [re_tests:376] trailing modifiers ok 377 # SKIP [re_tests:377] trailing modifiers ok 378 # SKIP [re_tests:378] trailing modifiers ok 379 # SKIP [re_tests:379] trailing modifiers ok 380 # SKIP [re_tests:380] trailing modifiers ok 381 # SKIP [re_tests:381] trailing modifiers ok 382 # SKIP [re_tests:382] trailing modifiers ok 383 # SKIP [re_tests:383] trailing modifiers ok 384 # SKIP [re_tests:384] trailing modifiers ok 385 # SKIP [re_tests:385] trailing modifiers ok 386 # SKIP [re_tests:386] trailing modifiers ok 387 # SKIP [re_tests:387] trailing modifiers ok 388 # SKIP [re_tests:388] trailing modifiers ok 389 # SKIP [re_tests:389] trailing modifiers ok 390 # SKIP [re_tests:390] trailing modifiers ok 391 # SKIP [re_tests:391] trailing modifiers ok 392 # SKIP [re_tests:392] trailing modifiers ok 393 # SKIP [re_tests:393] trailing modifiers ok 394 # SKIP [re_tests:394] trailing modifiers ok 395 # SKIP [re_tests:395] trailing modifiers not ok 396 # TODO [re_tests:396] unknown reason not ok 397 # TODO [re_tests:397] unknown reason not ok 398 # TODO [re_tests:398] unknown reason ok 408 # SKIP [re_tests:408] bug or error not ok 419 # TODO [re_tests:419] unknown reason not ok 422 # TODO [re_tests:422] unknown reason not ok 429 # TODO [re_tests:429] unknown reason not ok 432 # TODO [re_tests:432] unknown reason not ok 434 # TODO [re_tests:434] unknown reason not ok 435 # TODO [re_tests:435] unknown reason ok 436 # SKIP [re_tests:436] bug or error not ok 439 # TODO [re_tests:439] unknown reason not ok 446 # TODO [re_tests:446] unknown reason not ok 447 # TODO [re_tests:447] unknown reason not ok 448 # TODO [re_tests:448] unknown reason not ok 449 # TODO [re_tests:449] unknown reason not ok 452 # TODO [re_tests:452] unknown reason not ok 453 # TODO [re_tests:453] unknown reason not ok 454 # TODO [re_tests:454] unknown reason not ok 455 # TODO [re_tests:455] unknown reason ok 458 # SKIP [re_tests:458] unknown reason ok 459 # SKIP [re_tests:459] unknown reason ok 460 # SKIP [re_tests:460] unknown reason ok 461 # SKIP [re_tests:461] unknown reason ok 462 # SKIP [re_tests:462] unknown reason ok 463 # SKIP [re_tests:463] unknown reason ok 464 # SKIP [re_tests:464] unknown reason ok 465 # SKIP [re_tests:465] unknown reason ok 466 # SKIP [re_tests:466] unknown reason ok 467 # SKIP [re_tests:467] unknown reason ok 468 # SKIP [re_tests:468] unknown reason ok 469 # SKIP [re_tests:469] unknown reason ok 470 # SKIP [re_tests:470] unknown reason ok 471 # SKIP [re_tests:471] unknown reason ok 472 # SKIP [re_tests:472] unknown reason ok 473 # SKIP [re_tests:473] unknown reason ok 474 # SKIP [re_tests:474] unknown reason ok 475 # SKIP [re_tests:475] unknown reason ok 476 # SKIP [re_tests:476] unknown reason ok 477 # SKIP [re_tests:477] unknown reason ok 478 # SKIP [re_tests:478] unknown reason ok 479 # SKIP [re_tests:479] unknown reason ok 480 # SKIP [re_tests:480] unknown reason ok 483 # SKIP [re_tests:483] ok 484 # SKIP [re_tests:484] ok 487 # SKIP [re_tests:487] bug or error ok 488 # SKIP [re_tests:488] bug or error ok 489 # SKIP [re_tests:489] bug or error ok 490 # SKIP [re_tests:490] bug or error ok 491 # SKIP [re_tests:491] kills a parrot ok 492 # SKIP [re_tests:492] bug or error ok 493 # SKIP [re_tests:493] kills a parrot not ok 495 # TODO [re_tests:495] unknown reason ok 496 # SKIP [re_tests:496] not ok 498 # TODO [re_tests:498] unknown reason not ok 500 # TODO [re_tests:500] unknown reason not ok 501 # TODO [re_tests:501] unknown reason ok 502 # SKIP [re_tests:502] unknown reason not ok 503 # TODO [re_tests:503] unknown reason not ok 504 # TODO [re_tests:504] unknown reason not ok 505 # TODO [re_tests:505] unknown reason not ok 506 # TODO [re_tests:506] unknown reason not ok 507 # TODO [re_tests:507] unknown reason not ok 508 # TODO [re_tests:508] unknown reason not ok 509 # TODO [re_tests:509] unknown reason not ok 510 # TODO [re_tests:510] unknown reason not ok 511 # TODO [re_tests:511] unknown reason not ok 512 # TODO [re_tests:512] unknown reason not ok 515 # TODO [re_tests:515] unknown reason not ok 521 # TODO [re_tests:521] unknown reason not ok 522 # TODO [re_tests:522] unknown reason not ok 523 # TODO [re_tests:523] unknown reason not ok 524 # TODO [re_tests:524] unknown reason not ok 527 # TODO [re_tests:527] unknown reason not ok 528 # TODO [re_tests:528] unknown reason ok 531 # SKIP [re_tests:531] bug or error ok 532 # SKIP [re_tests:532] bug or error not ok 535 # TODO [re_tests:535] unknown reason not ok 536 # TODO [re_tests:536] unknown reason not ok 539 # TODO [re_tests:539] unknown reason not ok 540 # TODO [re_tests:540] unknown reason not ok 541 # TODO [re_tests:541] unknown reason not ok 544 # TODO [re_tests:544] unknown reason not ok 545 # TODO [re_tests:545] unknown reason ok 556 # SKIP [re_tests:556] kills a parrot ok 557 # SKIP [re_tests:557] kills a parrot not ok 559 # TODO [re_tests:559] unknown reason ok 563 # SKIP [re_tests:563] bug or error ok 564 # SKIP [re_tests:564] bug or error ok 566 # SKIP [re_tests:566] bug or error ok 568 # SKIP [re_tests:568] kills a parrot ok 569 # SKIP [re_tests:569] kills a parrot ok 570 # SKIP [re_tests:570] kills a parrot ok 571 # SKIP [re_tests:571] kills a parrot ok 572 # SKIP [re_tests:572] kills a parrot ok 573 # SKIP [re_tests:573] kills a parrot ok 574 # SKIP [re_tests:574] kills a parrot ok 575 # SKIP [re_tests:575] kills a parrot ok 576 # SKIP [re_tests:576] kills a parrot ok 577 # SKIP [re_tests:577] kills a parrot ok 578 # SKIP [re_tests:578] kills a parrot ok 579 # SKIP [re_tests:579] kills a parrot ok 580 # SKIP [re_tests:580] kills a parrot ok 581 # SKIP [re_tests:581] kills a parrot ok 582 # SKIP [re_tests:582] kills a parrot ok 583 # SKIP [re_tests:583] kills a parrot ok 584 # SKIP [re_tests:584] kills a parrot ok 585 # SKIP [re_tests:585] kills a parrot ok 586 # SKIP [re_tests:586] kills a parrot ok 587 # SKIP [re_tests:587] kills a parrot ok 588 # SKIP [re_tests:588] kills a parrot ok 589 # SKIP [re_tests:589] kills a parrot ok 590 # SKIP [re_tests:590] kills a parrot ok 591 # SKIP [re_tests:591] kills a parrot ok 592 # SKIP [re_tests:592] kills a parrot ok 593 # SKIP [re_tests:593] bug or error ok 594 # SKIP [re_tests:594] bug or error not ok 595 # TODO [re_tests:595] unknown reason not ok 596 # TODO [re_tests:596] unknown reason ok 597 # SKIP [re_tests:597] unknown reason ok 598 # SKIP [re_tests:598] bug or error ok 599 # SKIP [re_tests:599] bug or error not ok 600 # TODO [re_tests:600] unknown reason not ok 601 # TODO [re_tests:601] unknown reason not ok 603 # TODO [re_tests:603] unknown reason not ok 604 # TODO [re_tests:604] unknown reason not ok 606 # TODO [re_tests:606] unknown reason not ok 607 # TODO [re_tests:607] unknown reason ok 609 # SKIP [re_tests:609] unknown reason ok 610 # SKIP [re_tests:610] unknown reason ok 611 # SKIP [re_tests:611] unknown reason ok 612 # SKIP [re_tests:612] unknown reason ok 613 # SKIP [re_tests:613] unknown reason ok 614 # SKIP [re_tests:614] unknown reason ok 615 # SKIP [re_tests:615] unknown reason ok 616 # SKIP [re_tests:616] unknown reason ok 617 # SKIP [re_tests:617] unknown reason not ok 621 # TODO [re_tests:621] unknown reason not ok 623 # TODO [re_tests:623] unknown reason not ok 624 # TODO [re_tests:624] unknown reason not ok 625 # TODO [re_tests:625] unknown reason ok 627 # SKIP [re_tests:627] unknown reason ok 628 # SKIP [re_tests:628] unknown reason ok 629 # SKIP [re_tests:629] unknown reason ok 630 # SKIP [re_tests:630] unknown reason ok 631 # SKIP [re_tests:631] unknown reason ok 632 # SKIP [re_tests:632] unknown reason ok 633 # SKIP [re_tests:633] unknown reason ok 634 # SKIP [re_tests:634] unknown reason ok 635 # SKIP [re_tests:635] unknown reason not ok 639 # TODO [re_tests:639] unknown reason not ok 641 # TODO [re_tests:641] unknown reason not ok 642 # TODO [re_tests:642] unknown reason not ok 643 # TODO [re_tests:643] unknown reason ok 645 # SKIP [re_tests:645] unknown reason ok 646 # SKIP [re_tests:646] unknown reason ok 647 # SKIP [re_tests:647] unknown reason ok 648 # SKIP [re_tests:648] unknown reason ok 649 # SKIP [re_tests:649] unknown reason ok 650 # SKIP [re_tests:650] unknown reason ok 651 # SKIP [re_tests:651] unknown reason ok 652 # SKIP [re_tests:652] unknown reason ok 653 # SKIP [re_tests:653] unknown reason ok 663 # SKIP [re_tests:663] unknown reason ok 664 # SKIP [re_tests:664] unknown reason ok 665 # SKIP [re_tests:665] unknown reason ok 666 # SKIP [re_tests:666] unknown reason ok 667 # SKIP [re_tests:667] unknown reason ok 668 # SKIP [re_tests:668] unknown reason ok 669 # SKIP [re_tests:669] unknown reason ok 670 # SKIP [re_tests:670] unknown reason ok 671 # SKIP [re_tests:671] unknown reason ok 681 # SKIP [re_tests:681] unknown reason ok 682 # SKIP [re_tests:682] unknown reason ok 683 # SKIP [re_tests:683] unknown reason ok 684 # SKIP [re_tests:684] unknown reason ok 685 # SKIP [re_tests:685] unknown reason ok 686 # SKIP [re_tests:686] unknown reason ok 687 # SKIP [re_tests:687] unknown reason ok 688 # SKIP [re_tests:688] unknown reason ok 689 # SKIP [re_tests:689] unknown reason not ok 693 # TODO [re_tests:693] unknown reason not ok 695 # TODO [re_tests:695] unknown reason not ok 696 # TODO [re_tests:696] unknown reason not ok 697 # TODO [re_tests:697] unknown reason ok 699 # SKIP [re_tests:699] unknown reason ok 700 # SKIP [re_tests:700] unknown reason ok 701 # SKIP [re_tests:701] unknown reason ok 702 # SKIP [re_tests:702] unknown reason ok 703 # SKIP [re_tests:703] unknown reason ok 704 # SKIP [re_tests:704] unknown reason ok 705 # SKIP [re_tests:705] unknown reason ok 706 # SKIP [re_tests:706] unknown reason ok 707 # SKIP [re_tests:707] unknown reason ok 717 # SKIP [re_tests:717] unknown reason ok 718 # SKIP [re_tests:718] unknown reason ok 719 # SKIP [re_tests:719] unknown reason ok 720 # SKIP [re_tests:720] unknown reason ok 721 # SKIP [re_tests:721] unknown reason ok 722 # SKIP [re_tests:722] unknown reason ok 723 # SKIP [re_tests:723] unknown reason ok 724 # SKIP [re_tests:724] unknown reason ok 725 # SKIP [re_tests:725] unknown reason ok 735 # SKIP [re_tests:735] unknown reason ok 736 # SKIP [re_tests:736] unknown reason ok 737 # SKIP [re_tests:737] unknown reason ok 738 # SKIP [re_tests:738] unknown reason ok 739 # SKIP [re_tests:739] unknown reason ok 740 # SKIP [re_tests:740] unknown reason ok 741 # SKIP [re_tests:741] unknown reason ok 742 # SKIP [re_tests:742] unknown reason ok 743 # SKIP [re_tests:743] unknown reason not ok 747 # TODO [re_tests:747] unknown reason not ok 749 # TODO [re_tests:749] unknown reason not ok 750 # TODO [re_tests:750] unknown reason not ok 751 # TODO [re_tests:751] unknown reason ok 753 # SKIP [re_tests:753] unknown reason ok 754 # SKIP [re_tests:754] unknown reason ok 755 # SKIP [re_tests:755] unknown reason ok 756 # SKIP [re_tests:756] unknown reason ok 757 # SKIP [re_tests:757] unknown reason ok 758 # SKIP [re_tests:758] unknown reason ok 759 # SKIP [re_tests:759] unknown reason ok 760 # SKIP [re_tests:760] unknown reason ok 761 # SKIP [re_tests:761] unknown reason ok 771 # SKIP [re_tests:771] unknown reason ok 772 # SKIP [re_tests:772] unknown reason ok 773 # SKIP [re_tests:773] unknown reason ok 774 # SKIP [re_tests:774] unknown reason ok 775 # SKIP [re_tests:775] unknown reason ok 776 # SKIP [re_tests:776] unknown reason ok 777 # SKIP [re_tests:777] unknown reason ok 778 # SKIP [re_tests:778] unknown reason ok 779 # SKIP [re_tests:779] unknown reason ok 789 # SKIP [re_tests:789] unknown reason ok 790 # SKIP [re_tests:790] unknown reason ok 791 # SKIP [re_tests:791] unknown reason ok 792 # SKIP [re_tests:792] unknown reason ok 793 # SKIP [re_tests:793] unknown reason ok 794 # SKIP [re_tests:794] unknown reason ok 795 # SKIP [re_tests:795] unknown reason ok 796 # SKIP [re_tests:796] unknown reason ok 797 # SKIP [re_tests:797] unknown reason ok 800 # SKIP [re_tests:800] not ok 801 # TODO [re_tests:801] unknown reason ok 802 # SKIP [re_tests:802] ok 803 # SKIP [re_tests:803] ok 805 # SKIP [re_tests:805] ok 806 # SKIP [re_tests:806] hangs a parrot ok 807 # SKIP [re_tests:807] hangs a parrot ok 808 # SKIP [re_tests:808] hangs a parrot ok 809 # SKIP [re_tests:809] hangs a parrot ok 810 # SKIP [re_tests:810] hangs a parrot ok 811 # SKIP [re_tests:811] hangs a parrot ok 812 # SKIP [re_tests:812] hangs a parrot ok 813 # SKIP [re_tests:813] hangs a parrot ok 814 # SKIP [re_tests:814] hangs a parrot ok 815 # SKIP [re_tests:815] hangs a parrot ok 816 # SKIP [re_tests:816] hangs a parrot ok 817 # SKIP [re_tests:817] hangs a parrot ok 818 # SKIP [re_tests:818] hangs a parrot ok 819 # SKIP [re_tests:819] hangs a parrot ok 820 # SKIP [re_tests:820] hangs a parrot ok 821 # SKIP [re_tests:821] hangs a parrot ok 822 # SKIP [re_tests:822] hangs a parrot ok 823 # SKIP [re_tests:823] hangs a parrot not ok 827 # TODO [re_tests:827] \d in character class ok 828 # SKIP [re_tests:828] ok 829 # SKIP [re_tests:829] ok 830 # SKIP [re_tests:830] ok 834 # SKIP [re_tests:834] ok 835 # SKIP [re_tests:835] ok 836 # SKIP [re_tests:836] ok 838 # SKIP [re_tests:838] not ok 858 # TODO [re_tests:858] unknown reason ok 859 # SKIP [re_tests:859] ok 862 # SKIP [re_tests:862] not ok 865 # TODO [re_tests:865] unknown reason not ok 866 # TODO [re_tests:866] unknown reason ok 877 # SKIP [re_tests:877] ok 879 # SKIP [re_tests:879] [ID 20010811.006] not ok 881 # TODO [re_tests:881] unknown reason ok 886 # SKIP [re_tests:886] not ok 887 # TODO [re_tests:887] unknown reason not ok 888 # TODO [re_tests:888] unknown reason not ok 890 # TODO [re_tests:890] unknown reason not ok 891 # TODO [re_tests:891] unknown reason not ok 893 # TODO [re_tests:893] unknown reason not ok 896 # TODO [re_tests:896] unknown reason not ok 897 # TODO [re_tests:897] unknown reason not ok 898 # TODO [re_tests:898] unknown reason not ok 899 # TODO [re_tests:899] unknown reason not ok 901 # TODO [re_tests:901] greediness/lookbehind not ok 904 # TODO [re_tests:904] greediness/lookbehind not ok 905 # TODO [re_tests:905] greediness/lookbehind not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion not ok 915 # TODO [re_tests:915] non-greedy/lookbehind not ok 916 # TODO [re_tests:916] non-greedy/lookbehind not ok 918 # TODO [re_tests:918] non-greedy/lookbehind not ok 921 # TODO [re_tests:921] non-greedy/lookbehind not ok 922 # TODO [re_tests:922] non-greedy/lookbehind not ok 923 # TODO [re_tests:923] unmatched bracket ok 924 # SKIP [re_tests:924] ok 926 # SKIP [re_tests:926] [perl #18019] not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171] not ok 928 # TODO [re_tests:928] reuse captured group not ok 929 # TODO [re_tests:929] reuse captured group not ok 930 # TODO [re_tests:930] reuse captured group not ok 931 # TODO [re_tests:931] reuse captured group not ok 932 # TODO [re_tests:932] reuse captured group not ok 933 # TODO [re_tests:933] reuse captured group not ok 934 # TODO [re_tests:934] reuse captured group not ok 935 # TODO [re_tests:935] reuse captured group not ok 936 # TODO [re_tests:936] reuse captured group not ok 937 # TODO [re_tests:937] reuse captured group not ok 938 # TODO [re_tests:938] reuse captured group not ok 939 # TODO [re_tests:939] reuse captured group not ok 940 # TODO [re_tests:940] reuse captured group not ok 941 # TODO [re_tests:941] reuse captured group not ok 942 # TODO [re_tests:942] reuse captured group ok 944 # SKIP [re_tests:944] unknown reason ok 945 # SKIP [re_tests:945] unknown reason ok 957 # SKIP [re_tests:957] ok 958 # SKIP [re_tests:958] not ok 959 # TODO [re_tests:959] [perl #34195] not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion ok t/compilers/pge/perl6regex/01-regex.... not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&|) - parse error not ok 99 # TODO [rx_metachars:114] null pattern invalid not ok 386 # TODO [rx_backtrack:4] basic not ok 427 # TODO [rx_charclass:26] illegal character range not ok 458 # TODO [rx_charclass:62] literal match (\") not ok 459 # TODO [rx_charclass:64] literal match (\") not ok 460 # TODO [rx_charclass:66] literal match with quote not ok 461 # TODO [rx_charclass:68] literal match with quote not ok 462 # TODO [rx_charclass:70] literal match with backslash not ok 463 # TODO [rx_charclass:72] literal match with interpolation not ok 464 # TODO [rx_charclass:74] literal match with interpolation not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i) not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s) not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s) not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s) not ok 709 # TODO [rx_modifiers:131] basic ws match not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5) not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth) not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth) ok t/compilers/pge/perl6regex/context..... not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented ok t/compilers/tge/basic..................ok t/compilers/tge/grammar................ not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug ok t/compilers/tge/parser.................ok t/library/cgi_query_hash...............ok t/library/coroutine....................ok t/library/dumper.......................ok t/library/getopt_obj...................ok t/library/hllmacros....................ok t/library/iter.........................ok t/library/md5..........................ok t/library/mime_base64..................ok t/library/mt19937ar....................ok t/library/p6object..................... not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) > ok t/library/parrotlib....................ok t/library/pcre......................... ok 1 # SKIP no pcre-config ok t/library/pg........................... ok 1 # SKIP skipped ok 2 # SKIP skipped ok 3 # SKIP skipped ok 4 # SKIP skipped ok 5 # SKIP skipped ok 6 # SKIP skipped ok 7 # SKIP skipped ok 8 # SKIP skipped ok 9 # SKIP skipped ok 10 # SKIP skipped ok 11 # SKIP skipped ok 12 # SKIP skipped ok 13 # SKIP skipped ok 14 # SKIP skipped ok 15 # SKIP skipped ok 16 # SKIP skipped ok 17 # SKIP skipped ok 18 # SKIP skipped ok 19 # SKIP skipped ok 20 # SKIP skipped ok 21 # SKIP skipped ok 22 # SKIP skipped ok 23 # SKIP skipped ok 24 # SKIP skipped ok 25 # SKIP skipped ok 26 # SKIP skipped ok 27 # SKIP skipped ok 28 # SKIP skipped ok 29 # SKIP skipped ok 30 # SKIP skipped ok 31 # SKIP skipped ok 32 # SKIP skipped ok 33 # SKIP skipped ok 34 # SKIP skipped ok 35 # SKIP skipped ok 36 # SKIP skipped ok 37 # SKIP skipped ok 38 # SKIP skipped ok 39 # SKIP skipped ok 40 # SKIP skipped ok 41 # SKIP skipped ok 42 # SKIP skipped ok 43 # SKIP skipped ok t/library/protoobject..................ok t/library/rand.........................ok t/library/range........................ok t/library/streams...................... ok 18 # SKIP broken method invocation ok 20 # SKIP broken method invocation ok t/library/string_utils.................ok t/library/tcl_glob.....................ok t/library/tcl_lib......................ok t/library/test_builder_tester..........ok t/library/test_class...................ok t/library/test_more....................ok t/library/uuid.........................ok t/library/yaml_dumper.................. not ok 7 - properties # TODO not yet implemented not ok 8 - indent string # TODO not supported not ok 9 - back-referencing properties # TODO not yet implemented not ok 10 - self-referential properties (1) # TODO not yet implemented not ok 11 - self-referential properties (2) # TODO not yet implemented not ok 26 - custom dumper # TODO not yet implemented ok t/library/yaml_parser_syck............. not ok 1 - basic parsing # TODO Not properly implemented yet ok All tests successful. Files=252, Tests=8326, 656 wallclock secs ( 6.41 usr 4.34 sys + 193.79 cusr 125.22 csys = 329.76 CPU) Result: PASS perl t/harness --gc-debug --running-make-test -C --runcore-tests t/compilers/imcc/imcpasm/cfg...........ok t/compilers/imcc/imcpasm/opt0.......... ok 1 # SKIP disabled graph coloring register allocator, RT #57028 ok 3 # SKIP disabled graph coloring register allocator, RT #57028 ok t/compilers/imcc/imcpasm/opt1.......... ok 76 # SKIP constant concat N/Y ok t/compilers/imcc/imcpasm/opt2.......... ok 5 # SKIP loop opt disabled for now ok t/compilers/imcc/imcpasm/optc.......... not ok 9 - tailcall 1 # TODO RT #57028 ok t/compilers/imcc/imcpasm/pcc...........ok t/compilers/imcc/imcpasm/sub...........ok t/compilers/imcc/reg/alloc.............ok t/compilers/imcc/reg/spill.............ok t/compilers/imcc/syn/bsr...............ok t/compilers/imcc/syn/clash............. not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet ok t/compilers/imcc/syn/const.............ok t/compilers/imcc/syn/errors............ok t/compilers/imcc/syn/eval.............. ok 1 # SKIP changed eval semantics - see t/pmc/eval.t ok 2 # SKIP changed eval semantics - see t/pmc/eval.t ok 3 # SKIP changed eval semantics - see t/pmc/eval.t ok 4 # SKIP changed eval semantics - see t/pmc/eval.t ok 5 # SKIP changed eval semantics - see t/pmc/eval.t ok 6 # SKIP changed eval semantics - see t/pmc/eval.t ok 7 # SKIP changed eval semantics - see t/pmc/eval.t ok t/compilers/imcc/syn/file.............. ok 13 # SKIP multiple loading not speced - failing ok t/compilers/imcc/syn/hll...............ok t/compilers/imcc/syn/keyed............. ok 1 # SKIP experimental ok t/compilers/imcc/syn/labels............ok t/compilers/imcc/syn/macro............. not ok 25 - unterminated macro 2 # TODO Darwin segfault -- RT #60926 ok t/compilers/imcc/syn/objects...........ok t/compilers/imcc/syn/op................ok t/compilers/imcc/syn/pasm..............ok t/compilers/imcc/syn/pcc...............ok t/compilers/imcc/syn/pod............... ok 4 # SKIP Closing out of pod from included files ok t/compilers/imcc/syn/regressions....... not ok 4 - comments between .param(RT \#46499) # TODO broken not ok 6 - whitespace between .param(RT \#46499) # TODO broken not ok 7 - off by one error message (RT \#40204) # TODO broken ok t/compilers/imcc/syn/scope.............ok t/compilers/imcc/syn/subflags.......... not ok 15 # TODO :method sub not found in namespace ok t/compilers/imcc/syn/symbols...........ok t/compilers/imcc/syn/tail..............ok t/compilers/imcc/syn/veracity..........ok t/op/00ff-dos..........................ok t/op/00ff-unix.........................ok t/op/01-parse_ops......................ok t/op/64bit............................. 1..0 # Skip 64bit INTVAL platforms only skipped: 64bit INTVAL platforms only t/op/annotate..........................ok t/op/arithmetics....................... ok 28 # SKIP No integer overflow for 32-bit INTVALs without GMP installed ok t/op/basic.............................ok t/op/bitwise........................... ok 27 # SKIP no BigInt lib found ok t/op/box...............................ok t/op/calling........................... not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all not ok 93 - arg mismatch with no params # TODO RT #39844 ok t/op/cc_params.........................ok t/op/cc_state.......................... not ok 6 - positional found, named expected # TODO cc processor state missing not ok 8 - G2: argument underflow: required slurpy param # TODO failing ok t/op/cmp-nonbranch.....................ok t/op/comp..............................ok t/op/copy..............................ok t/op/debuginfo.........................ok t/op/exceptions........................ not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans ok t/op/gc................................ok t/op/globals...........................ok t/op/hacks............................. ok 1 # SKIP no universal SIGFPE handling ok 2 # SKIP no universal SIGFPE handling ok t/op/ifunless..........................ok t/op/integer...........................ok t/op/interp............................ ok 1 # SKIP we really shouldn't run just a label - use a sub ok t/op/io................................ok t/op/jit...............................ok t/op/jitn..............................ok t/op/lexicals.......................... not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented ok t/op/literal...........................ok t/op/load_bytecode.....................ok t/op/number............................ok t/op/pushaction........................ not ok 7 - pushaction: error while handling error # TODO runloop shenanigans ok t/op/say...............................ok t/op/spawnw............................ok t/op/sprintf........................... ok 5 # SKIP parrot extension (%B) ok 7 # SKIP perl5-specific extension (%D) ok 9 # SKIP perl5-specific extension (%F) ok 16 # SKIP parrot extension (%H) ok 20 # SKIP parrot extension (%L) ok 23 # SKIP perl5-specific extension (%O) ok 24 # SKIP parrot extension (%P) ok 27 # SKIP parrot extension (%S) ok 29 # SKIP perl5-specific extension (%U) not ok 64 # TODO [%03.2d] actual: > 01< ok 71 # SKIP perl5-specific extension (%v...) ok 72 # SKIP perl5-specific extension (%v...) ok 73 # SKIP perl5-specific extension (%v...) ok 74 # SKIP perl5-specific extension (%v...) ok 75 # SKIP perl5-specific extension (%v...) ok 76 # SKIP perl5-specific extension (%v...) ok 77 # SKIP perl5-specific extension (%v...) ok 78 # SKIP perl5-specific extension (%v...) ok 79 # SKIP perl5-specific extension (%v...) ok 80 # SKIP perl5-specific extension (%v...) ok 81 # SKIP perl5-specific extension (%v...) ok 82 # SKIP perl5-specific extension (%v...) ok 83 # SKIP perl5-specific extension (%v...) ok 84 # SKIP perl5-specific extension (%v...) ok 85 # SKIP perl5-specific extension (%v...) ok 86 # SKIP perl5-specific extension (%v...) ok 87 # SKIP perl5-specific extension (%v...) ok 88 # SKIP perl5-specific extension (%v...) ok 89 # SKIP perl5-specific extension (%v...) ok 90 # SKIP perl5-specific extension (%v...) ok 91 # SKIP perl5-specific extension (%v...) ok 92 # SKIP perl5-specific extension (%v...) ok 93 # SKIP perl5-specific extension (%v...) ok 94 # SKIP perl5-specific extension (%v...) ok 95 # SKIP perl5-specific extension (%v...) ok 96 # SKIP perl5-specific extension (%v...) ok 97 # SKIP perl5-specific extension (%v...) ok 98 # SKIP perl5-specific extension (%v...) ok 99 # SKIP perl5-specific extension (%v...) ok 114 # SKIP harness needs support for * modifier ok 131 # SKIP harness needs support for * modifier ok 141 # SKIP harness needs support for * modifier ok 144 # SKIP perl5 expresssion as test value not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1< ok 161 # SKIP harness needs support for * modifier ok 166 # SKIP harness needs support for * modifier not ok 187 # TODO [%h] actual: >< not ok 191 # TODO [%l] actual: >< ok 193 # SKIP perl5-specific test ok 200 # SKIP perl5-specific test ok 201 # SKIP perl5-specific test ok 202 # SKIP parrot extension (%p) ok 204 # SKIP parrot extension (%r) ok 210 # SKIP harness needs support for * modifier ok 214 # SKIP harness needs support for * modifier not ok 223 # TODO [%v] actual: >< ok 233 # SKIP harness needs support for * modifier ok 234 # SKIP perl5-specific extension (%v...) ok 235 # SKIP perl5-specific extension (%v...) ok 238 # SKIP perl5-specific test ok 239 # SKIP perl5-specific test ok 240 # SKIP perl5-specific test ok 241 # SKIP perl5-specific test ok 242 # SKIP perl5-specific test ok 243 # SKIP perl5-specific test ok 244 # SKIP perl5-specific test ok 245 # SKIP perl5-specific test ok 246 # SKIP perl5-specific test ok 247 # SKIP perl5-specific test ok 248 # SKIP perl5-specific test ok 249 # SKIP perl5-specific test ok 250 # SKIP perl5-specific test ok 251 # SKIP perl5-specific test ok 252 # SKIP perl5-specific extension (%v...) ok 253 # SKIP perl5-specific extension (%v...) ok 254 # SKIP perl5-specific extension (%v...) ok 255 # SKIP perl5-specific extension (%v...) ok 256 # SKIP perl5-specific extension (%v...) ok 257 # SKIP perl5-specific extension (%v...) ok 258 # SKIP perl5-specific extension (%v...) ok 259 # SKIP perl5-specific extension (%v...) ok 260 # SKIP perl5-specific extension (%v...) ok 261 # SKIP perl5-specific extension (%v...) ok 262 # SKIP perl5-specific extension (%v...) ok 263 # SKIP perl5-specific extension (%v...) ok 264 # SKIP perl5-specific extension (%v...) ok 265 # SKIP perl5-specific extension (%v...) ok 266 # SKIP perl5-specific extension (%v...) ok 267 # SKIP perl5-specific extension (%v...) ok 268 # SKIP perl5-specific extension (%v...) ok 269 # SKIP perl5-specific extension (%v...) ok 270 # SKIP perl5-specific extension (%v...) ok 271 # SKIP perl5-specific extension (%v...) ok 272 # SKIP perl5-specific extension (%v...) ok 273 # SKIP perl5-specific extension (%v...) ok 274 # SKIP perl5-specific extension (%v...) ok 275 # SKIP perl5-specific extension (%v...) ok 276 # SKIP perl5-specific extension (%v...) ok 277 # SKIP perl5-specific extension (%v...) ok 278 # SKIP perl5-specific extension (%v...) ok 279 # SKIP perl5-specific extension (%v...) ok 280 # SKIP perl5-specific extension (%v...) ok 281 # SKIP perl5-specific extension (%v...) ok 282 # SKIP perl5-specific extension (%v...) ok 283 # SKIP perl5-specific extension (%v...) ok 284 # SKIP perl5-specific extension (%v...) ok 285 # SKIP perl5-specific extension (%v...) ok 286 # SKIP perl5-specific extension (%v...) ok 287 # SKIP perl5-specific extension (%v...) ok 288 # SKIP perl5-specific extension (%v...) ok 289 # SKIP perl5-specific extension (%v...) ok 290 # SKIP perl5-specific extension (%v...) ok 291 # SKIP perl5-specific extension (%v...) ok 292 # SKIP perl5-specific extension (%v...) ok 293 # SKIP perl5-specific extension (%v...) ok 294 # SKIP perl5-specific extension (%v...) ok 295 # SKIP perl5-specific extension (%v...) ok 296 # SKIP perl5-specific extension (%v...) ok 297 # SKIP perl5-specific extension (%v...) ok 298 # SKIP perl5-specific extension (%v...) ok 300 # SKIP harness needs support for * modifier not ok 304 # TODO [%#b] actual: >0b0< not ok 305 # TODO [%#o] actual: >00< not ok 306 # TODO [%#x] actual: >0x0< ok 307 # SKIP perl5-specific extension (%v...) ok 308 # SKIP perl5-specific extension (%v...) ok t/op/sprintf2..........................ok t/op/string............................ ok 103 # SKIP Pending rework of creating non-ascii literals ok 104 # SKIP Pending rework of creating non-ascii literals ok 118 # SKIP Pending reimplementation of find_encoding ok 119 # SKIP no more visible encoding ok 137 # SKIP No unicode yet ok 139 # SKIP no more transcode ok 140 # SKIP no more chartype ok t/op/string_cclass..................... ok 7 # SKIP unicode support unavailable ok 8 # SKIP unicode support unavailable ok 9 # SKIP unicode support unavailable ok t/op/string_cs......................... ok 31 # SKIP no ICU lib ok 32 # SKIP no ICU lib ok 33 # SKIP no ICU lib ok 34 # SKIP no ICU lib ok 35 # SKIP no ICU lib ok 36 # SKIP no ICU lib ok 37 # SKIP no ICU lib ok 38 # SKIP no ICU lib ok 39 # SKIP no ICU lib ok 40 # SKIP no ICU lib ok 41 # SKIP no ICU lib ok 42 # SKIP no ICU lib ok 43 # SKIP no ICU lib ok 44 # SKIP no ICU lib ok 45 # SKIP no ICU lib ok 46 # SKIP no ICU lib ok t/op/string_mem........................ok t/op/stringu........................... ok 20 # SKIP no ICU lib ok 21 # SKIP no ICU lib ok 22 # SKIP no ICU lib ok 25 # SKIP Tests seem to fail on big endian machines with icu ok 26 # SKIP Tests seem to fail on big endian machines with icu not ok 27 - UTF-8 and Unicode literals # TODO TT #24 ok t/op/sysinfo........................... not ok 11 - sysinfo OS version string # TODO Not Currently Implemented not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented ok 13 # SKIP Requires a lot of work to find out the correct answer ok 14 # SKIP Testing only in some known platforms ok t/op/time..............................ok t/op/trans.............................ok t/pmc/addrregistry.....................ok t/pmc/array............................ not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken ok t/pmc/bigint........................... 1..0 # Skip No BigInt Lib configured skipped: No BigInt Lib configured t/pmc/bignum........................... 1..0 # Skip No BigNum PMC enabled skipped: No BigNum PMC enabled t/pmc/boolean..........................ok t/pmc/bound_nci........................ok t/pmc/callsignature....................ok t/pmc/capture..........................ok t/pmc/class............................ not ok 28 # TODO add_method() invoking method added to class works ok t/pmc/codestring.......................ok t/pmc/complex.......................... ok 58 # SKIP div by zero not caught ok 59 # SKIP div by zero not caught ok 60 # SKIP div by zero not caught ok 86 # SKIP instantiate n/y ok 87 # SKIP instantiate n/y ok 88 # SKIP instantiate n/y ok 89 # SKIP instantiate n/y ok 126 # SKIP inf is not platform-independent ok 465 # SKIP add using subclass of Complex - RT #59630 ok 466 # SKIP add using subclass of Complex - RT #59630 ok 467 # SKIP add using subclass of Complex - RT #59630 ok t/pmc/config...........................ok t/pmc/continuation.....................ok t/pmc/coroutine........................ not ok 9 - Call an exited coroutine # TODO goes one iteration too far. ok t/pmc/cpointer.........................ok t/pmc/default.......................... not ok 1 - new # TODO not implemeted ok t/pmc/env..............................ok t/pmc/eval.............................ok t/pmc/eventhandler.....................ok t/pmc/exception........................ not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans not ok 25 - pushaction: error while handling error # TODO runloop shenanigans not ok 27 - invoke handler in calling sub # TODO deprecate rethrow ok 30 - catch ex from C-level MULTI function # TODO broken ok t/pmc/exceptionhandler.................ok t/pmc/exporter.........................ok t/pmc/file.............................ok t/pmc/filehandle....................... ok 3 # SKIP no asynch calls yet not ok 8 - record_separator # TODO not yet implemented ok t/pmc/fixedbooleanarray................ok t/pmc/fixedfloatarray..................ok t/pmc/fixedintegerarray................ok t/pmc/fixedpmcarray....................ok t/pmc/fixedstringarray.................ok t/pmc/float............................ok t/pmc/freeze...........................ok t/pmc/globals..........................ok t/pmc/hash.............................ok t/pmc/integer..........................ok t/pmc/io............................... not ok 1 - IO on some invalid types # TODO IO on some invalid types ok 8 # SKIP clone not finished yet not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433 not ok 40 - string read/write handle # TODO no stringhandle yet ok t/pmc/io_iterator...................... not ok 1 - new # TODO not yet implemented not ok 2 - shift # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented ok t/pmc/io_status........................ not ok 1 - new # TODO not yet implemented not ok 2 - get_integer (vtable) # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented not ok 4 - return # TODO not yet implemented not ok 5 - error # TODO not yet implemented not ok 6 - throw # TODO not yet implemented ok t/pmc/iterator......................... ok 13 # SKIP N/Y: length of rest of array not ok 16 - adding keys during iteration # TODO adding keys during iteration not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points' ok t/pmc/key.............................. not ok 10 # TODO register and non-register string keys should be COW (RT #60128) ok t/pmc/lexinfo..........................ok t/pmc/lexpad...........................ok t/pmc/managedstruct....................ok t/pmc/multidispatch.................... not ok 22 - MMD on PMC types - Any # TODO RT #41374 not ok 25 - add as method - inherited # TODO RT #41374 not ok 32 - use a core func for an object # TODO RT #59628 ok t/pmc/multisub.........................ok t/pmc/namespace........................ not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17 ok t/pmc/nci..............................ok t/pmc/null.............................ok t/pmc/object-meths..................... ok 14 # SKIP currently broken ok 25 # SKIP no bound NCI method ok t/pmc/object-mro.......................ok t/pmc/object...........................ok t/pmc/objects..........................ok t/pmc/orderedhash......................ok t/pmc/os...............................ok t/pmc/packfile.........................ok t/pmc/packfileconstanttable............ not ok 3 - get_type, get_*_keyed_int # TODO See TT #385. ok t/pmc/packfiledirectory................ok t/pmc/packfilefixupentry...............ok t/pmc/packfilefixuptable...............ok t/pmc/packfilerawsegment...............ok t/pmc/packfilesegment..................ok t/pmc/parrotclass......................ok t/pmc/parrotinterpreter................ok t/pmc/parrotio......................... not ok 2 - open and close - synchronous # TODO not yet implemented ok 3 # SKIP no asynch calls yet not ok 4 - print, read, and readline - synchronous # TODO not yet implemented not ok 5 - record_separator # TODO not yet implemented not ok 6 - buffer_type # TODO not yet implemented ok t/pmc/parrotlibrary....................ok t/pmc/parrotobject.....................ok t/pmc/parrotrunningthread..............ok t/pmc/parrotthread.....................ok t/pmc/pccmethod_test...................ok t/pmc/pmc..............................ok t/pmc/pmcproxy.........................ok t/pmc/pointer..........................ok t/pmc/prop.............................ok t/pmc/random...........................ok t/pmc/ref..............................ok t/pmc/resizablebooleanarray............ok t/pmc/resizablefloatarray..............ok t/pmc/resizableintegerarray............ok t/pmc/resizablepmcarray................ok t/pmc/resizablestringarray.............ok t/pmc/retcontinuation..................ok t/pmc/ro............................... not ok 8 - ResizablePMCArray -- Recursive # TODO 1 ok t/pmc/role.............................ok t/pmc/scalar........................... ok 1 # SKIP doesn't work yet ok t/pmc/scheduler........................ok t/pmc/schedulermessage.................ok t/pmc/sharedref........................ok t/pmc/signal........................... 1..0 # Skip Signals currently disabled skipped: Signals currently disabled t/pmc/slice............................ not ok 2 - bug with slice bits # TODO parser ok t/pmc/string...........................ok t/pmc/stringhandle..................... ok 3 # SKIP no asynch calls yet not ok 9 - record_separator # TODO not yet implemented ok t/pmc/sub..............................ok t/pmc/sys..............................ok t/pmc/task.............................ok t/pmc/threads.......................... not ok 11 - CLONE_CODE | CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511 not ok 14 - globals + constant table subs issue # TODO Broken with CGP not ok 15 - CLONE_CODE|CLONE_GLOBALS|CLONE_HLL|CLONE_LIBRARIES # TODO RT #41373 ok t/pmc/timer............................ok t/pmc/undef............................ok t/pmc/unmanagedstruct..................ok t/oo/attributes........................ok t/oo/composition.......................ok t/oo/inheritance.......................ok t/oo/isa...............................ok t/oo/metamodel......................... not ok 6 # TODO tail attribute has a type not ok 12 # TODO new opcode makes working objects ok t/oo/methods...........................ok t/oo/mro-c3............................ok t/oo/names.............................ok t/oo/new...............................ok t/oo/ops...............................ok t/oo/proxy.............................ok t/oo/subclass..........................ok t/oo/vtableoverride....................ok t/native_pbc/header.................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/native_pbc/integer................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/native_pbc/number.................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/native_pbc/string.................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/dynpmc/dynlexpad..................... not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads ok t/dynpmc/foo........................... ok 6 # SKIP No BigInt Lib configured ok t/dynpmc/gdbmhash...................... 1..0 # Skip No gdbm library available skipped: No gdbm library available t/dynpmc/md2...........................ok t/dynpmc/md4...........................ok t/dynpmc/md5...........................ok t/dynpmc/pair..........................ok t/dynpmc/rational......................ok t/dynpmc/ripemd160.....................ok t/dynpmc/rotest........................ok t/dynpmc/sha...........................ok t/dynpmc/sha1..........................ok t/dynpmc/sha256........................ 1..0 # Skip Too old library skipped: Too old library t/dynpmc/sha512........................ 1..0 # Skip Too old library skipped: Too old library t/dynpmc/subclass_with_pir_method...... not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces ok t/dynpmc/subproxy......................ok t/dynoplibs/dan........................ok t/dynoplibs/myops......................ok t/compilers/pct/complete_workflow......ok t/compilers/pct/past...................ok t/compilers/pct/pct_hllcompiler........ok t/compilers/pct/post...................ok t/compilers/pge/00-basic...............ok t/compilers/pge/02-match...............ok t/compilers/pge/03-optable.............ok t/compilers/pge/04-compile.............ok t/compilers/pge/06-grammar.............ok t/compilers/pge/pge-hs.................ok t/compilers/pge/pge....................ok t/compilers/pge/pge_examples...........ok t/compilers/pge/pge_globs..............ok t/compilers/pge/pge_text...............ok t/compilers/pge/pge_util...............ok t/compilers/pge/p5regex/p5rx........... not ok 116 # TODO [re_tests:116] character class in enumeration not ok 119 # TODO [re_tests:119] character class in enumeration not ok 120 # TODO [re_tests:120] character class in enumeration not ok 123 # TODO [re_tests:123] character class in enumeration not ok 124 # TODO [re_tests:124] character class in enumeration not ok 127 # TODO [re_tests:127] character class in enumeration ok 138 # SKIP [re_tests:138] parser bug ok 139 # SKIP [re_tests:139] broken col 4? ok 143 # SKIP [re_tests:143] bug or error ok 144 # SKIP [re_tests:144] bug or error ok 148 # SKIP [re_tests:148] bug or error ok 149 # SKIP [re_tests:149] bug or error ok 155 # SKIP [re_tests:155] bug or error ok 167 # SKIP [re_tests:167] bug or error not ok 234 # TODO [re_tests:234] unknown reason not ok 235 # TODO [re_tests:235] unknown reason not ok 236 # TODO [re_tests:236] unknown reason not ok 246 # TODO [re_tests:246] unknown reason not ok 247 # TODO [re_tests:247] unknown reason ok 248 # SKIP [re_tests:248] bug or error ok 249 # SKIP [re_tests:249] bug or error ok 252 # SKIP [re_tests:252] bug or error not ok 254 # TODO [re_tests:254] unknown reason not ok 256 # TODO [re_tests:256] unknown reason not ok 257 # TODO [re_tests:257] unknown reason ok 264 # SKIP [re_tests:264] trailing modifiers ok 265 # SKIP [re_tests:265] trailing modifiers ok 266 # SKIP [re_tests:266] trailing modifiers ok 267 # SKIP [re_tests:267] trailing modifiers ok 268 # SKIP [re_tests:268] trailing modifiers ok 269 # SKIP [re_tests:269] trailing modifiers ok 270 # SKIP [re_tests:270] trailing modifiers ok 271 # SKIP [re_tests:271] trailing modifiers ok 272 # SKIP [re_tests:272] trailing modifiers ok 273 # SKIP [re_tests:273] trailing modifiers ok 274 # SKIP [re_tests:274] trailing modifiers ok 275 # SKIP [re_tests:275] trailing modifiers ok 276 # SKIP [re_tests:276] trailing modifiers ok 277 # SKIP [re_tests:277] trailing modifiers ok 278 # SKIP [re_tests:278] trailing modifiers ok 279 # SKIP [re_tests:279] trailing modifiers ok 280 # SKIP [re_tests:280] trailing modifiers ok 281 # SKIP [re_tests:281] trailing modifiers ok 282 # SKIP [re_tests:282] trailing modifiers ok 283 # SKIP [re_tests:283] trailing modifiers ok 284 # SKIP [re_tests:284] trailing modifiers ok 285 # SKIP [re_tests:285] trailing modifiers ok 286 # SKIP [re_tests:286] trailing modifiers ok 287 # SKIP [re_tests:287] trailing modifiers ok 288 # SKIP [re_tests:288] trailing modifiers ok 289 # SKIP [re_tests:289] trailing modifiers ok 290 # SKIP [re_tests:290] trailing modifiers ok 291 # SKIP [re_tests:291] trailing modifiers ok 292 # SKIP [re_tests:292] trailing modifiers ok 293 # SKIP [re_tests:293] trailing modifiers ok 294 # SKIP [re_tests:294] trailing modifiers ok 295 # SKIP [re_tests:295] trailing modifiers ok 296 # SKIP [re_tests:296] trailing modifiers ok 297 # SKIP [re_tests:297] trailing modifiers ok 298 # SKIP [re_tests:298] trailing modifiers ok 299 # SKIP [re_tests:299] trailing modifiers ok 300 # SKIP [re_tests:300] trailing modifiers ok 301 # SKIP [re_tests:301] trailing modifiers ok 302 # SKIP [re_tests:302] trailing modifiers ok 303 # SKIP [re_tests:303] trailing modifiers ok 304 # SKIP [re_tests:304] trailing modifiers ok 305 # SKIP [re_tests:305] trailing modifiers ok 306 # SKIP [re_tests:306] trailing modifiers ok 307 # SKIP [re_tests:307] trailing modifiers ok 308 # SKIP [re_tests:308] bug or error ok 309 # SKIP [re_tests:309] bug or error ok 310 # SKIP [re_tests:310] bug or error ok 311 # SKIP [re_tests:311] trailing modifiers ok 312 # SKIP [re_tests:312] trailing modifiers ok 313 # SKIP [re_tests:313] trailing modifiers ok 314 # SKIP [re_tests:314] trailing modifiers ok 315 # SKIP [re_tests:315] trailing modifiers ok 316 # SKIP [re_tests:316] trailing modifiers ok 317 # SKIP [re_tests:317] trailing modifiers ok 318 # SKIP [re_tests:318] trailing modifiers ok 319 # SKIP [re_tests:319] trailing modifiers ok 320 # SKIP [re_tests:320] trailing modifiers ok 321 # SKIP [re_tests:321] trailing modifiers ok 322 # SKIP [re_tests:322] bug or error ok 323 # SKIP [re_tests:323] bug or error ok 324 # SKIP [re_tests:324] trailing modifiers ok 325 # SKIP [re_tests:325] bug or error ok 326 # SKIP [re_tests:326] trailing modifiers ok 327 # SKIP [re_tests:327] trailing modifiers ok 328 # SKIP [re_tests:328] trailing modifiers ok 329 # SKIP [re_tests:329] trailing modifiers ok 330 # SKIP [re_tests:330] bug or error ok 331 # SKIP [re_tests:331] bug or error ok 332 # SKIP [re_tests:332] trailing modifiers ok 333 # SKIP [re_tests:333] trailing modifiers ok 334 # SKIP [re_tests:334] trailing modifiers ok 335 # SKIP [re_tests:335] trailing modifiers ok 336 # SKIP [re_tests:336] bug or error ok 337 # SKIP [re_tests:337] trailing modifiers ok 338 # SKIP [re_tests:338] trailing modifiers ok 339 # SKIP [re_tests:339] trailing modifiers ok 340 # SKIP [re_tests:340] trailing modifiers ok 341 # SKIP [re_tests:341] trailing modifiers ok 342 # SKIP [re_tests:342] trailing modifiers ok 343 # SKIP [re_tests:343] trailing modifiers ok 344 # SKIP [re_tests:344] trailing modifiers ok 345 # SKIP [re_tests:345] trailing modifiers ok 346 # SKIP [re_tests:346] trailing modifiers ok 347 # SKIP [re_tests:347] bug or error ok 348 # SKIP [re_tests:348] trailing modifiers ok 349 # SKIP [re_tests:349] trailing modifiers ok 350 # SKIP [re_tests:350] trailing modifiers ok 351 # SKIP [re_tests:351] trailing modifiers ok 352 # SKIP [re_tests:352] trailing modifiers ok 353 # SKIP [re_tests:353] trailing modifiers ok 354 # SKIP [re_tests:354] trailing modifiers ok 355 # SKIP [re_tests:355] trailing modifiers ok 356 # SKIP [re_tests:356] trailing modifiers ok 357 # SKIP [re_tests:357] trailing modifiers ok 358 # SKIP [re_tests:358] trailing modifiers ok 359 # SKIP [re_tests:359] trailing modifiers ok 360 # SKIP [re_tests:360] trailing modifiers ok 361 # SKIP [re_tests:361] trailing modifiers ok 362 # SKIP [re_tests:362] trailing modifiers ok 363 # SKIP [re_tests:363] trailing modifiers ok 364 # SKIP [re_tests:364] trailing modifiers ok 365 # SKIP [re_tests:365] trailing modifiers ok 366 # SKIP [re_tests:366] trailing modifiers ok 367 # SKIP [re_tests:367] trailing modifiers ok 368 # SKIP [re_tests:368] trailing modifiers ok 369 # SKIP [re_tests:369] trailing modifiers ok 370 # SKIP [re_tests:370] trailing modifiers ok 371 # SKIP [re_tests:371] trailing modifiers ok 372 # SKIP [re_tests:372] trailing modifiers ok 373 # SKIP [re_tests:373] trailing modifiers ok 374 # SKIP [re_tests:374] trailing modifiers ok 375 # SKIP [re_tests:375] trailing modifiers ok 376 # SKIP [re_tests:376] trailing modifiers ok 377 # SKIP [re_tests:377] trailing modifiers ok 378 # SKIP [re_tests:378] trailing modifiers ok 379 # SKIP [re_tests:379] trailing modifiers ok 380 # SKIP [re_tests:380] trailing modifiers ok 381 # SKIP [re_tests:381] trailing modifiers ok 382 # SKIP [re_tests:382] trailing modifiers ok 383 # SKIP [re_tests:383] trailing modifiers ok 384 # SKIP [re_tests:384] trailing modifiers ok 385 # SKIP [re_tests:385] trailing modifiers ok 386 # SKIP [re_tests:386] trailing modifiers ok 387 # SKIP [re_tests:387] trailing modifiers ok 388 # SKIP [re_tests:388] trailing modifiers ok 389 # SKIP [re_tests:389] trailing modifiers ok 390 # SKIP [re_tests:390] trailing modifiers ok 391 # SKIP [re_tests:391] trailing modifiers ok 392 # SKIP [re_tests:392] trailing modifiers ok 393 # SKIP [re_tests:393] trailing modifiers ok 394 # SKIP [re_tests:394] trailing modifiers ok 395 # SKIP [re_tests:395] trailing modifiers not ok 396 # TODO [re_tests:396] unknown reason not ok 397 # TODO [re_tests:397] unknown reason not ok 398 # TODO [re_tests:398] unknown reason ok 408 # SKIP [re_tests:408] bug or error not ok 419 # TODO [re_tests:419] unknown reason not ok 422 # TODO [re_tests:422] unknown reason not ok 429 # TODO [re_tests:429] unknown reason not ok 432 # TODO [re_tests:432] unknown reason not ok 434 # TODO [re_tests:434] unknown reason not ok 435 # TODO [re_tests:435] unknown reason ok 436 # SKIP [re_tests:436] bug or error not ok 439 # TODO [re_tests:439] unknown reason not ok 446 # TODO [re_tests:446] unknown reason not ok 447 # TODO [re_tests:447] unknown reason not ok 448 # TODO [re_tests:448] unknown reason not ok 449 # TODO [re_tests:449] unknown reason not ok 452 # TODO [re_tests:452] unknown reason not ok 453 # TODO [re_tests:453] unknown reason not ok 454 # TODO [re_tests:454] unknown reason not ok 455 # TODO [re_tests:455] unknown reason ok 458 # SKIP [re_tests:458] unknown reason ok 459 # SKIP [re_tests:459] unknown reason ok 460 # SKIP [re_tests:460] unknown reason ok 461 # SKIP [re_tests:461] unknown reason ok 462 # SKIP [re_tests:462] unknown reason ok 463 # SKIP [re_tests:463] unknown reason ok 464 # SKIP [re_tests:464] unknown reason ok 465 # SKIP [re_tests:465] unknown reason ok 466 # SKIP [re_tests:466] unknown reason ok 467 # SKIP [re_tests:467] unknown reason ok 468 # SKIP [re_tests:468] unknown reason ok 469 # SKIP [re_tests:469] unknown reason ok 470 # SKIP [re_tests:470] unknown reason ok 471 # SKIP [re_tests:471] unknown reason ok 472 # SKIP [re_tests:472] unknown reason ok 473 # SKIP [re_tests:473] unknown reason ok 474 # SKIP [re_tests:474] unknown reason ok 475 # SKIP [re_tests:475] unknown reason ok 476 # SKIP [re_tests:476] unknown reason ok 477 # SKIP [re_tests:477] unknown reason ok 478 # SKIP [re_tests:478] unknown reason ok 479 # SKIP [re_tests:479] unknown reason ok 480 # SKIP [re_tests:480] unknown reason ok 483 # SKIP [re_tests:483] ok 484 # SKIP [re_tests:484] ok 487 # SKIP [re_tests:487] bug or error ok 488 # SKIP [re_tests:488] bug or error ok 489 # SKIP [re_tests:489] bug or error ok 490 # SKIP [re_tests:490] bug or error ok 491 # SKIP [re_tests:491] kills a parrot ok 492 # SKIP [re_tests:492] bug or error ok 493 # SKIP [re_tests:493] kills a parrot not ok 495 # TODO [re_tests:495] unknown reason ok 496 # SKIP [re_tests:496] not ok 498 # TODO [re_tests:498] unknown reason not ok 500 # TODO [re_tests:500] unknown reason not ok 501 # TODO [re_tests:501] unknown reason ok 502 # SKIP [re_tests:502] unknown reason not ok 503 # TODO [re_tests:503] unknown reason not ok 504 # TODO [re_tests:504] unknown reason not ok 505 # TODO [re_tests:505] unknown reason not ok 506 # TODO [re_tests:506] unknown reason not ok 507 # TODO [re_tests:507] unknown reason not ok 508 # TODO [re_tests:508] unknown reason not ok 509 # TODO [re_tests:509] unknown reason not ok 510 # TODO [re_tests:510] unknown reason not ok 511 # TODO [re_tests:511] unknown reason not ok 512 # TODO [re_tests:512] unknown reason not ok 515 # TODO [re_tests:515] unknown reason not ok 521 # TODO [re_tests:521] unknown reason not ok 522 # TODO [re_tests:522] unknown reason not ok 523 # TODO [re_tests:523] unknown reason not ok 524 # TODO [re_tests:524] unknown reason not ok 527 # TODO [re_tests:527] unknown reason not ok 528 # TODO [re_tests:528] unknown reason ok 531 # SKIP [re_tests:531] bug or error ok 532 # SKIP [re_tests:532] bug or error not ok 535 # TODO [re_tests:535] unknown reason not ok 536 # TODO [re_tests:536] unknown reason not ok 539 # TODO [re_tests:539] unknown reason not ok 540 # TODO [re_tests:540] unknown reason not ok 541 # TODO [re_tests:541] unknown reason not ok 544 # TODO [re_tests:544] unknown reason not ok 545 # TODO [re_tests:545] unknown reason ok 556 # SKIP [re_tests:556] kills a parrot ok 557 # SKIP [re_tests:557] kills a parrot not ok 559 # TODO [re_tests:559] unknown reason ok 563 # SKIP [re_tests:563] bug or error ok 564 # SKIP [re_tests:564] bug or error ok 566 # SKIP [re_tests:566] bug or error ok 568 # SKIP [re_tests:568] kills a parrot ok 569 # SKIP [re_tests:569] kills a parrot ok 570 # SKIP [re_tests:570] kills a parrot ok 571 # SKIP [re_tests:571] kills a parrot ok 572 # SKIP [re_tests:572] kills a parrot ok 573 # SKIP [re_tests:573] kills a parrot ok 574 # SKIP [re_tests:574] kills a parrot ok 575 # SKIP [re_tests:575] kills a parrot ok 576 # SKIP [re_tests:576] kills a parrot ok 577 # SKIP [re_tests:577] kills a parrot ok 578 # SKIP [re_tests:578] kills a parrot ok 579 # SKIP [re_tests:579] kills a parrot ok 580 # SKIP [re_tests:580] kills a parrot ok 581 # SKIP [re_tests:581] kills a parrot ok 582 # SKIP [re_tests:582] kills a parrot ok 583 # SKIP [re_tests:583] kills a parrot ok 584 # SKIP [re_tests:584] kills a parrot ok 585 # SKIP [re_tests:585] kills a parrot ok 586 # SKIP [re_tests:586] kills a parrot ok 587 # SKIP [re_tests:587] kills a parrot ok 588 # SKIP [re_tests:588] kills a parrot ok 589 # SKIP [re_tests:589] kills a parrot ok 590 # SKIP [re_tests:590] kills a parrot ok 591 # SKIP [re_tests:591] kills a parrot ok 592 # SKIP [re_tests:592] kills a parrot ok 593 # SKIP [re_tests:593] bug or error ok 594 # SKIP [re_tests:594] bug or error not ok 595 # TODO [re_tests:595] unknown reason not ok 596 # TODO [re_tests:596] unknown reason ok 597 # SKIP [re_tests:597] unknown reason ok 598 # SKIP [re_tests:598] bug or error ok 599 # SKIP [re_tests:599] bug or error not ok 600 # TODO [re_tests:600] unknown reason not ok 601 # TODO [re_tests:601] unknown reason not ok 603 # TODO [re_tests:603] unknown reason not ok 604 # TODO [re_tests:604] unknown reason not ok 606 # TODO [re_tests:606] unknown reason not ok 607 # TODO [re_tests:607] unknown reason ok 609 # SKIP [re_tests:609] unknown reason ok 610 # SKIP [re_tests:610] unknown reason ok 611 # SKIP [re_tests:611] unknown reason ok 612 # SKIP [re_tests:612] unknown reason ok 613 # SKIP [re_tests:613] unknown reason ok 614 # SKIP [re_tests:614] unknown reason ok 615 # SKIP [re_tests:615] unknown reason ok 616 # SKIP [re_tests:616] unknown reason ok 617 # SKIP [re_tests:617] unknown reason not ok 621 # TODO [re_tests:621] unknown reason not ok 623 # TODO [re_tests:623] unknown reason not ok 624 # TODO [re_tests:624] unknown reason not ok 625 # TODO [re_tests:625] unknown reason ok 627 # SKIP [re_tests:627] unknown reason ok 628 # SKIP [re_tests:628] unknown reason ok 629 # SKIP [re_tests:629] unknown reason ok 630 # SKIP [re_tests:630] unknown reason ok 631 # SKIP [re_tests:631] unknown reason ok 632 # SKIP [re_tests:632] unknown reason ok 633 # SKIP [re_tests:633] unknown reason ok 634 # SKIP [re_tests:634] unknown reason ok 635 # SKIP [re_tests:635] unknown reason not ok 639 # TODO [re_tests:639] unknown reason not ok 641 # TODO [re_tests:641] unknown reason not ok 642 # TODO [re_tests:642] unknown reason not ok 643 # TODO [re_tests:643] unknown reason ok 645 # SKIP [re_tests:645] unknown reason ok 646 # SKIP [re_tests:646] unknown reason ok 647 # SKIP [re_tests:647] unknown reason ok 648 # SKIP [re_tests:648] unknown reason ok 649 # SKIP [re_tests:649] unknown reason ok 650 # SKIP [re_tests:650] unknown reason ok 651 # SKIP [re_tests:651] unknown reason ok 652 # SKIP [re_tests:652] unknown reason ok 653 # SKIP [re_tests:653] unknown reason ok 663 # SKIP [re_tests:663] unknown reason ok 664 # SKIP [re_tests:664] unknown reason ok 665 # SKIP [re_tests:665] unknown reason ok 666 # SKIP [re_tests:666] unknown reason ok 667 # SKIP [re_tests:667] unknown reason ok 668 # SKIP [re_tests:668] unknown reason ok 669 # SKIP [re_tests:669] unknown reason ok 670 # SKIP [re_tests:670] unknown reason ok 671 # SKIP [re_tests:671] unknown reason ok 681 # SKIP [re_tests:681] unknown reason ok 682 # SKIP [re_tests:682] unknown reason ok 683 # SKIP [re_tests:683] unknown reason ok 684 # SKIP [re_tests:684] unknown reason ok 685 # SKIP [re_tests:685] unknown reason ok 686 # SKIP [re_tests:686] unknown reason ok 687 # SKIP [re_tests:687] unknown reason ok 688 # SKIP [re_tests:688] unknown reason ok 689 # SKIP [re_tests:689] unknown reason not ok 693 # TODO [re_tests:693] unknown reason not ok 695 # TODO [re_tests:695] unknown reason not ok 696 # TODO [re_tests:696] unknown reason not ok 697 # TODO [re_tests:697] unknown reason ok 699 # SKIP [re_tests:699] unknown reason ok 700 # SKIP [re_tests:700] unknown reason ok 701 # SKIP [re_tests:701] unknown reason ok 702 # SKIP [re_tests:702] unknown reason ok 703 # SKIP [re_tests:703] unknown reason ok 704 # SKIP [re_tests:704] unknown reason ok 705 # SKIP [re_tests:705] unknown reason ok 706 # SKIP [re_tests:706] unknown reason ok 707 # SKIP [re_tests:707] unknown reason ok 717 # SKIP [re_tests:717] unknown reason ok 718 # SKIP [re_tests:718] unknown reason ok 719 # SKIP [re_tests:719] unknown reason ok 720 # SKIP [re_tests:720] unknown reason ok 721 # SKIP [re_tests:721] unknown reason ok 722 # SKIP [re_tests:722] unknown reason ok 723 # SKIP [re_tests:723] unknown reason ok 724 # SKIP [re_tests:724] unknown reason ok 725 # SKIP [re_tests:725] unknown reason ok 735 # SKIP [re_tests:735] unknown reason ok 736 # SKIP [re_tests:736] unknown reason ok 737 # SKIP [re_tests:737] unknown reason ok 738 # SKIP [re_tests:738] unknown reason ok 739 # SKIP [re_tests:739] unknown reason ok 740 # SKIP [re_tests:740] unknown reason ok 741 # SKIP [re_tests:741] unknown reason ok 742 # SKIP [re_tests:742] unknown reason ok 743 # SKIP [re_tests:743] unknown reason not ok 747 # TODO [re_tests:747] unknown reason not ok 749 # TODO [re_tests:749] unknown reason not ok 750 # TODO [re_tests:750] unknown reason not ok 751 # TODO [re_tests:751] unknown reason ok 753 # SKIP [re_tests:753] unknown reason ok 754 # SKIP [re_tests:754] unknown reason ok 755 # SKIP [re_tests:755] unknown reason ok 756 # SKIP [re_tests:756] unknown reason ok 757 # SKIP [re_tests:757] unknown reason ok 758 # SKIP [re_tests:758] unknown reason ok 759 # SKIP [re_tests:759] unknown reason ok 760 # SKIP [re_tests:760] unknown reason ok 761 # SKIP [re_tests:761] unknown reason ok 771 # SKIP [re_tests:771] unknown reason ok 772 # SKIP [re_tests:772] unknown reason ok 773 # SKIP [re_tests:773] unknown reason ok 774 # SKIP [re_tests:774] unknown reason ok 775 # SKIP [re_tests:775] unknown reason ok 776 # SKIP [re_tests:776] unknown reason ok 777 # SKIP [re_tests:777] unknown reason ok 778 # SKIP [re_tests:778] unknown reason ok 779 # SKIP [re_tests:779] unknown reason ok 789 # SKIP [re_tests:789] unknown reason ok 790 # SKIP [re_tests:790] unknown reason ok 791 # SKIP [re_tests:791] unknown reason ok 792 # SKIP [re_tests:792] unknown reason ok 793 # SKIP [re_tests:793] unknown reason ok 794 # SKIP [re_tests:794] unknown reason ok 795 # SKIP [re_tests:795] unknown reason ok 796 # SKIP [re_tests:796] unknown reason ok 797 # SKIP [re_tests:797] unknown reason ok 800 # SKIP [re_tests:800] not ok 801 # TODO [re_tests:801] unknown reason ok 802 # SKIP [re_tests:802] ok 803 # SKIP [re_tests:803] ok 805 # SKIP [re_tests:805] ok 806 # SKIP [re_tests:806] hangs a parrot ok 807 # SKIP [re_tests:807] hangs a parrot ok 808 # SKIP [re_tests:808] hangs a parrot ok 809 # SKIP [re_tests:809] hangs a parrot ok 810 # SKIP [re_tests:810] hangs a parrot ok 811 # SKIP [re_tests:811] hangs a parrot ok 812 # SKIP [re_tests:812] hangs a parrot ok 813 # SKIP [re_tests:813] hangs a parrot ok 814 # SKIP [re_tests:814] hangs a parrot ok 815 # SKIP [re_tests:815] hangs a parrot ok 816 # SKIP [re_tests:816] hangs a parrot ok 817 # SKIP [re_tests:817] hangs a parrot ok 818 # SKIP [re_tests:818] hangs a parrot ok 819 # SKIP [re_tests:819] hangs a parrot ok 820 # SKIP [re_tests:820] hangs a parrot ok 821 # SKIP [re_tests:821] hangs a parrot ok 822 # SKIP [re_tests:822] hangs a parrot ok 823 # SKIP [re_tests:823] hangs a parrot not ok 827 # TODO [re_tests:827] \d in character class ok 828 # SKIP [re_tests:828] ok 829 # SKIP [re_tests:829] ok 830 # SKIP [re_tests:830] ok 834 # SKIP [re_tests:834] ok 835 # SKIP [re_tests:835] ok 836 # SKIP [re_tests:836] ok 838 # SKIP [re_tests:838] not ok 858 # TODO [re_tests:858] unknown reason ok 859 # SKIP [re_tests:859] ok 862 # SKIP [re_tests:862] not ok 865 # TODO [re_tests:865] unknown reason not ok 866 # TODO [re_tests:866] unknown reason ok 877 # SKIP [re_tests:877] ok 879 # SKIP [re_tests:879] [ID 20010811.006] not ok 881 # TODO [re_tests:881] unknown reason ok 886 # SKIP [re_tests:886] not ok 887 # TODO [re_tests:887] unknown reason not ok 888 # TODO [re_tests:888] unknown reason not ok 890 # TODO [re_tests:890] unknown reason not ok 891 # TODO [re_tests:891] unknown reason not ok 893 # TODO [re_tests:893] unknown reason not ok 896 # TODO [re_tests:896] unknown reason not ok 897 # TODO [re_tests:897] unknown reason not ok 898 # TODO [re_tests:898] unknown reason not ok 899 # TODO [re_tests:899] unknown reason not ok 901 # TODO [re_tests:901] greediness/lookbehind not ok 904 # TODO [re_tests:904] greediness/lookbehind not ok 905 # TODO [re_tests:905] greediness/lookbehind not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion not ok 915 # TODO [re_tests:915] non-greedy/lookbehind not ok 916 # TODO [re_tests:916] non-greedy/lookbehind not ok 918 # TODO [re_tests:918] non-greedy/lookbehind not ok 921 # TODO [re_tests:921] non-greedy/lookbehind not ok 922 # TODO [re_tests:922] non-greedy/lookbehind not ok 923 # TODO [re_tests:923] unmatched bracket ok 924 # SKIP [re_tests:924] ok 926 # SKIP [re_tests:926] [perl #18019] not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171] not ok 928 # TODO [re_tests:928] reuse captured group not ok 929 # TODO [re_tests:929] reuse captured group not ok 930 # TODO [re_tests:930] reuse captured group not ok 931 # TODO [re_tests:931] reuse captured group not ok 932 # TODO [re_tests:932] reuse captured group not ok 933 # TODO [re_tests:933] reuse captured group not ok 934 # TODO [re_tests:934] reuse captured group not ok 935 # TODO [re_tests:935] reuse captured group not ok 936 # TODO [re_tests:936] reuse captured group not ok 937 # TODO [re_tests:937] reuse captured group not ok 938 # TODO [re_tests:938] reuse captured group not ok 939 # TODO [re_tests:939] reuse captured group not ok 940 # TODO [re_tests:940] reuse captured group not ok 941 # TODO [re_tests:941] reuse captured group not ok 942 # TODO [re_tests:942] reuse captured group ok 944 # SKIP [re_tests:944] unknown reason ok 945 # SKIP [re_tests:945] unknown reason ok 957 # SKIP [re_tests:957] ok 958 # SKIP [re_tests:958] not ok 959 # TODO [re_tests:959] [perl #34195] not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion ok t/compilers/pge/perl6regex/01-regex.... not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&|) - parse error not ok 99 # TODO [rx_metachars:114] null pattern invalid not ok 386 # TODO [rx_backtrack:4] basic not ok 427 # TODO [rx_charclass:26] illegal character range not ok 458 # TODO [rx_charclass:62] literal match (\") not ok 459 # TODO [rx_charclass:64] literal match (\") not ok 460 # TODO [rx_charclass:66] literal match with quote not ok 461 # TODO [rx_charclass:68] literal match with quote not ok 462 # TODO [rx_charclass:70] literal match with backslash not ok 463 # TODO [rx_charclass:72] literal match with interpolation not ok 464 # TODO [rx_charclass:74] literal match with interpolation not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i) not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s) not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s) not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s) not ok 709 # TODO [rx_modifiers:131] basic ws match not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5) not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth) not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth) ok t/compilers/pge/perl6regex/context..... not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented ok t/compilers/tge/basic..................ok t/compilers/tge/grammar................ not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug ok t/compilers/tge/parser.................ok t/library/cgi_query_hash...............ok t/library/coroutine....................ok t/library/dumper.......................ok t/library/getopt_obj...................ok t/library/hllmacros....................ok t/library/iter.........................ok t/library/md5..........................ok t/library/mime_base64..................ok t/library/mt19937ar....................ok t/library/p6object..................... not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) > ok t/library/parrotlib....................ok t/library/pcre......................... ok 1 # SKIP no pcre-config ok t/library/pg........................... ok 1 # SKIP skipped ok 2 # SKIP skipped ok 3 # SKIP skipped ok 4 # SKIP skipped ok 5 # SKIP skipped ok 6 # SKIP skipped ok 7 # SKIP skipped ok 8 # SKIP skipped ok 9 # SKIP skipped ok 10 # SKIP skipped ok 11 # SKIP skipped ok 12 # SKIP skipped ok 13 # SKIP skipped ok 14 # SKIP skipped ok 15 # SKIP skipped ok 16 # SKIP skipped ok 17 # SKIP skipped ok 18 # SKIP skipped ok 19 # SKIP skipped ok 20 # SKIP skipped ok 21 # SKIP skipped ok 22 # SKIP skipped ok 23 # SKIP skipped ok 24 # SKIP skipped ok 25 # SKIP skipped ok 26 # SKIP skipped ok 27 # SKIP skipped ok 28 # SKIP skipped ok 29 # SKIP skipped ok 30 # SKIP skipped ok 31 # SKIP skipped ok 32 # SKIP skipped ok 33 # SKIP skipped ok 34 # SKIP skipped ok 35 # SKIP skipped ok 36 # SKIP skipped ok 37 # SKIP skipped ok 38 # SKIP skipped ok 39 # SKIP skipped ok 40 # SKIP skipped ok 41 # SKIP skipped ok 42 # SKIP skipped ok 43 # SKIP skipped ok t/library/protoobject..................ok t/library/rand.........................ok t/library/range........................ok t/library/streams...................... ok 18 # SKIP broken method invocation ok 20 # SKIP broken method invocation ok t/library/string_utils.................ok t/library/tcl_glob.....................ok t/library/tcl_lib......................ok t/library/test_builder_tester..........ok t/library/test_class...................ok t/library/test_more....................ok t/library/uuid.........................ok t/library/yaml_dumper.................. not ok 7 - properties # TODO not yet implemented not ok 8 - indent string # TODO not supported not ok 9 - back-referencing properties # TODO not yet implemented not ok 10 - self-referential properties (1) # TODO not yet implemented not ok 11 - self-referential properties (2) # TODO not yet implemented not ok 26 - custom dumper # TODO not yet implemented ok t/library/yaml_parser_syck............. not ok 1 - basic parsing # TODO Not properly implemented yet ok All tests successful. Test Summary Report ------------------- t/pmc/exception (Wstat: 0 Tests: 31 Failed: 0) TODO passed: 30 Files=252, Tests=8326, 459 wallclock secs ( 6.10 usr 4.04 sys + 188.72 cusr 114.40 csys = 313.26 CPU) Result: PASS perl t/harness --gc-debug --running-make-test -f --runcore-tests t/compilers/imcc/imcpasm/cfg...........ok t/compilers/imcc/imcpasm/opt0.......... ok 1 # SKIP disabled graph coloring register allocator, RT #57028 ok 3 # SKIP disabled graph coloring register allocator, RT #57028 ok t/compilers/imcc/imcpasm/opt1.......... ok 76 # SKIP constant concat N/Y ok t/compilers/imcc/imcpasm/opt2.......... ok 5 # SKIP loop opt disabled for now ok t/compilers/imcc/imcpasm/optc.......... not ok 9 - tailcall 1 # TODO RT #57028 ok t/compilers/imcc/imcpasm/pcc...........ok t/compilers/imcc/imcpasm/sub...........ok t/compilers/imcc/reg/alloc.............ok t/compilers/imcc/reg/spill.............ok t/compilers/imcc/syn/bsr...............ok t/compilers/imcc/syn/clash............. not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet ok t/compilers/imcc/syn/const.............ok t/compilers/imcc/syn/errors............ok t/compilers/imcc/syn/eval.............. ok 1 # SKIP changed eval semantics - see t/pmc/eval.t ok 2 # SKIP changed eval semantics - see t/pmc/eval.t ok 3 # SKIP changed eval semantics - see t/pmc/eval.t ok 4 # SKIP changed eval semantics - see t/pmc/eval.t ok 5 # SKIP changed eval semantics - see t/pmc/eval.t ok 6 # SKIP changed eval semantics - see t/pmc/eval.t ok 7 # SKIP changed eval semantics - see t/pmc/eval.t ok t/compilers/imcc/syn/file.............. ok 13 # SKIP multiple loading not speced - failing ok t/compilers/imcc/syn/hll...............ok t/compilers/imcc/syn/keyed............. ok 1 # SKIP experimental ok t/compilers/imcc/syn/labels............ok t/compilers/imcc/syn/macro............. not ok 25 - unterminated macro 2 # TODO Darwin segfault -- RT #60926 ok t/compilers/imcc/syn/objects...........ok t/compilers/imcc/syn/op................ok t/compilers/imcc/syn/pasm..............ok t/compilers/imcc/syn/pcc...............ok t/compilers/imcc/syn/pod............... ok 4 # SKIP Closing out of pod from included files ok t/compilers/imcc/syn/regressions....... not ok 4 - comments between .param(RT \#46499) # TODO broken not ok 6 - whitespace between .param(RT \#46499) # TODO broken not ok 7 - off by one error message (RT \#40204) # TODO broken ok t/compilers/imcc/syn/scope.............ok t/compilers/imcc/syn/subflags.......... not ok 15 # TODO :method sub not found in namespace ok t/compilers/imcc/syn/symbols...........ok t/compilers/imcc/syn/tail..............ok t/compilers/imcc/syn/veracity..........ok t/op/00ff-dos..........................ok t/op/00ff-unix.........................ok t/op/01-parse_ops......................ok t/op/64bit............................. 1..0 # Skip 64bit INTVAL platforms only skipped: 64bit INTVAL platforms only t/op/annotate..........................ok t/op/arithmetics....................... ok 28 # SKIP No integer overflow for 32-bit INTVALs without GMP installed ok t/op/basic.............................ok t/op/bitwise........................... ok 27 # SKIP no BigInt lib found ok t/op/box...............................ok t/op/calling........................... not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all not ok 93 - arg mismatch with no params # TODO RT #39844 ok t/op/cc_params.........................ok t/op/cc_state.......................... not ok 6 - positional found, named expected # TODO cc processor state missing not ok 8 - G2: argument underflow: required slurpy param # TODO failing ok t/op/cmp-nonbranch.....................ok t/op/comp..............................ok t/op/copy..............................ok t/op/debuginfo......................... ok 1 # SKIP disabled on fast-core ok 7 # SKIP disabled on this core ok 8 # SKIP disabled on this core ok t/op/exceptions........................ not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans ok t/op/gc................................ok t/op/globals...........................ok t/op/hacks............................. ok 1 # SKIP no universal SIGFPE handling ok 2 # SKIP no universal SIGFPE handling ok t/op/ifunless..........................ok t/op/integer...........................ok t/op/interp............................ ok 1 # SKIP we really shouldn't run just a label - use a sub ok t/op/io................................ok t/op/jit...............................ok t/op/jitn..............................ok t/op/lexicals.......................... not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented ok t/op/literal...........................ok t/op/load_bytecode.....................ok t/op/number............................ok t/op/pushaction........................ not ok 7 - pushaction: error while handling error # TODO runloop shenanigans ok t/op/say...............................ok t/op/spawnw............................ok t/op/sprintf........................... ok 5 # SKIP parrot extension (%B) ok 7 # SKIP perl5-specific extension (%D) ok 9 # SKIP perl5-specific extension (%F) ok 16 # SKIP parrot extension (%H) ok 20 # SKIP parrot extension (%L) ok 23 # SKIP perl5-specific extension (%O) ok 24 # SKIP parrot extension (%P) ok 27 # SKIP parrot extension (%S) ok 29 # SKIP perl5-specific extension (%U) not ok 64 # TODO [%03.2d] actual: > 01< ok 71 # SKIP perl5-specific extension (%v...) ok 72 # SKIP perl5-specific extension (%v...) ok 73 # SKIP perl5-specific extension (%v...) ok 74 # SKIP perl5-specific extension (%v...) ok 75 # SKIP perl5-specific extension (%v...) ok 76 # SKIP perl5-specific extension (%v...) ok 77 # SKIP perl5-specific extension (%v...) ok 78 # SKIP perl5-specific extension (%v...) ok 79 # SKIP perl5-specific extension (%v...) ok 80 # SKIP perl5-specific extension (%v...) ok 81 # SKIP perl5-specific extension (%v...) ok 82 # SKIP perl5-specific extension (%v...) ok 83 # SKIP perl5-specific extension (%v...) ok 84 # SKIP perl5-specific extension (%v...) ok 85 # SKIP perl5-specific extension (%v...) ok 86 # SKIP perl5-specific extension (%v...) ok 87 # SKIP perl5-specific extension (%v...) ok 88 # SKIP perl5-specific extension (%v...) ok 89 # SKIP perl5-specific extension (%v...) ok 90 # SKIP perl5-specific extension (%v...) ok 91 # SKIP perl5-specific extension (%v...) ok 92 # SKIP perl5-specific extension (%v...) ok 93 # SKIP perl5-specific extension (%v...) ok 94 # SKIP perl5-specific extension (%v...) ok 95 # SKIP perl5-specific extension (%v...) ok 96 # SKIP perl5-specific extension (%v...) ok 97 # SKIP perl5-specific extension (%v...) ok 98 # SKIP perl5-specific extension (%v...) ok 99 # SKIP perl5-specific extension (%v...) ok 114 # SKIP harness needs support for * modifier ok 131 # SKIP harness needs support for * modifier ok 141 # SKIP harness needs support for * modifier ok 144 # SKIP perl5 expresssion as test value not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1< ok 161 # SKIP harness needs support for * modifier ok 166 # SKIP harness needs support for * modifier not ok 187 # TODO [%h] actual: >< not ok 191 # TODO [%l] actual: >< ok 193 # SKIP perl5-specific test ok 200 # SKIP perl5-specific test ok 201 # SKIP perl5-specific test ok 202 # SKIP parrot extension (%p) ok 204 # SKIP parrot extension (%r) ok 210 # SKIP harness needs support for * modifier ok 214 # SKIP harness needs support for * modifier not ok 223 # TODO [%v] actual: >< ok 233 # SKIP harness needs support for * modifier ok 234 # SKIP perl5-specific extension (%v...) ok 235 # SKIP perl5-specific extension (%v...) ok 238 # SKIP perl5-specific test ok 239 # SKIP perl5-specific test ok 240 # SKIP perl5-specific test ok 241 # SKIP perl5-specific test ok 242 # SKIP perl5-specific test ok 243 # SKIP perl5-specific test ok 244 # SKIP perl5-specific test ok 245 # SKIP perl5-specific test ok 246 # SKIP perl5-specific test ok 247 # SKIP perl5-specific test ok 248 # SKIP perl5-specific test ok 249 # SKIP perl5-specific test ok 250 # SKIP perl5-specific test ok 251 # SKIP perl5-specific test ok 252 # SKIP perl5-specific extension (%v...) ok 253 # SKIP perl5-specific extension (%v...) ok 254 # SKIP perl5-specific extension (%v...) ok 255 # SKIP perl5-specific extension (%v...) ok 256 # SKIP perl5-specific extension (%v...) ok 257 # SKIP perl5-specific extension (%v...) ok 258 # SKIP perl5-specific extension (%v...) ok 259 # SKIP perl5-specific extension (%v...) ok 260 # SKIP perl5-specific extension (%v...) ok 261 # SKIP perl5-specific extension (%v...) ok 262 # SKIP perl5-specific extension (%v...) ok 263 # SKIP perl5-specific extension (%v...) ok 264 # SKIP perl5-specific extension (%v...) ok 265 # SKIP perl5-specific extension (%v...) ok 266 # SKIP perl5-specific extension (%v...) ok 267 # SKIP perl5-specific extension (%v...) ok 268 # SKIP perl5-specific extension (%v...) ok 269 # SKIP perl5-specific extension (%v...) ok 270 # SKIP perl5-specific extension (%v...) ok 271 # SKIP perl5-specific extension (%v...) ok 272 # SKIP perl5-specific extension (%v...) ok 273 # SKIP perl5-specific extension (%v...) ok 274 # SKIP perl5-specific extension (%v...) ok 275 # SKIP perl5-specific extension (%v...) ok 276 # SKIP perl5-specific extension (%v...) ok 277 # SKIP perl5-specific extension (%v...) ok 278 # SKIP perl5-specific extension (%v...) ok 279 # SKIP perl5-specific extension (%v...) ok 280 # SKIP perl5-specific extension (%v...) ok 281 # SKIP perl5-specific extension (%v...) ok 282 # SKIP perl5-specific extension (%v...) ok 283 # SKIP perl5-specific extension (%v...) ok 284 # SKIP perl5-specific extension (%v...) ok 285 # SKIP perl5-specific extension (%v...) ok 286 # SKIP perl5-specific extension (%v...) ok 287 # SKIP perl5-specific extension (%v...) ok 288 # SKIP perl5-specific extension (%v...) ok 289 # SKIP perl5-specific extension (%v...) ok 290 # SKIP perl5-specific extension (%v...) ok 291 # SKIP perl5-specific extension (%v...) ok 292 # SKIP perl5-specific extension (%v...) ok 293 # SKIP perl5-specific extension (%v...) ok 294 # SKIP perl5-specific extension (%v...) ok 295 # SKIP perl5-specific extension (%v...) ok 296 # SKIP perl5-specific extension (%v...) ok 297 # SKIP perl5-specific extension (%v...) ok 298 # SKIP perl5-specific extension (%v...) ok 300 # SKIP harness needs support for * modifier not ok 304 # TODO [%#b] actual: >0b0< not ok 305 # TODO [%#o] actual: >00< not ok 306 # TODO [%#x] actual: >0x0< ok 307 # SKIP perl5-specific extension (%v...) ok 308 # SKIP perl5-specific extension (%v...) ok t/op/sprintf2..........................ok t/op/string............................ ok 103 # SKIP Pending rework of creating non-ascii literals ok 104 # SKIP Pending rework of creating non-ascii literals ok 118 # SKIP Pending reimplementation of find_encoding ok 119 # SKIP no more visible encoding ok 137 # SKIP No unicode yet ok 139 # SKIP no more transcode ok 140 # SKIP no more chartype ok t/op/string_cclass..................... ok 7 # SKIP unicode support unavailable ok 8 # SKIP unicode support unavailable ok 9 # SKIP unicode support unavailable ok t/op/string_cs......................... ok 31 # SKIP no ICU lib ok 32 # SKIP no ICU lib ok 33 # SKIP no ICU lib ok 34 # SKIP no ICU lib ok 35 # SKIP no ICU lib ok 36 # SKIP no ICU lib ok 37 # SKIP no ICU lib ok 38 # SKIP no ICU lib ok 39 # SKIP no ICU lib ok 40 # SKIP no ICU lib ok 41 # SKIP no ICU lib ok 42 # SKIP no ICU lib ok 43 # SKIP no ICU lib ok 44 # SKIP no ICU lib ok 45 # SKIP no ICU lib ok 46 # SKIP no ICU lib ok t/op/string_mem........................ok t/op/stringu........................... ok 20 # SKIP no ICU lib ok 21 # SKIP no ICU lib ok 22 # SKIP no ICU lib ok 25 # SKIP Tests seem to fail on big endian machines with icu ok 26 # SKIP Tests seem to fail on big endian machines with icu not ok 27 - UTF-8 and Unicode literals # TODO TT #24 ok t/op/sysinfo........................... not ok 11 - sysinfo OS version string # TODO Not Currently Implemented not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented ok 13 # SKIP Requires a lot of work to find out the correct answer ok 14 # SKIP Testing only in some known platforms ok t/op/time..............................ok t/op/trans.............................ok t/pmc/addrregistry.....................ok t/pmc/array............................ not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken ok t/pmc/bigint........................... 1..0 # Skip No BigInt Lib configured skipped: No BigInt Lib configured t/pmc/bignum........................... 1..0 # Skip No BigNum PMC enabled skipped: No BigNum PMC enabled t/pmc/boolean..........................ok t/pmc/bound_nci........................ok t/pmc/callsignature....................ok t/pmc/capture..........................ok t/pmc/class............................ not ok 28 # TODO add_method() invoking method added to class works ok t/pmc/codestring.......................ok t/pmc/complex.......................... ok 58 # SKIP div by zero not caught ok 59 # SKIP div by zero not caught ok 60 # SKIP div by zero not caught ok 86 # SKIP instantiate n/y ok 87 # SKIP instantiate n/y ok 88 # SKIP instantiate n/y ok 89 # SKIP instantiate n/y ok 126 # SKIP inf is not platform-independent ok 465 # SKIP add using subclass of Complex - RT #59630 ok 466 # SKIP add using subclass of Complex - RT #59630 ok 467 # SKIP add using subclass of Complex - RT #59630 ok t/pmc/config...........................ok t/pmc/continuation.....................ok t/pmc/coroutine........................ not ok 9 - Call an exited coroutine # TODO goes one iteration too far. ok t/pmc/cpointer.........................ok t/pmc/default.......................... not ok 1 - new # TODO not implemeted ok t/pmc/env..............................ok t/pmc/eval.............................ok t/pmc/eventhandler.....................ok t/pmc/exception........................ not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans not ok 25 - pushaction: error while handling error # TODO runloop shenanigans not ok 27 - invoke handler in calling sub # TODO deprecate rethrow not ok 30 - catch ex from C-level MULTI function # TODO broken ok t/pmc/exceptionhandler.................ok t/pmc/exporter.........................ok t/pmc/file.............................ok t/pmc/filehandle....................... ok 3 # SKIP no asynch calls yet not ok 8 - record_separator # TODO not yet implemented ok t/pmc/fixedbooleanarray................ok t/pmc/fixedfloatarray..................ok t/pmc/fixedintegerarray................ok t/pmc/fixedpmcarray....................ok t/pmc/fixedstringarray.................ok t/pmc/float............................ok t/pmc/freeze...........................ok t/pmc/globals..........................ok t/pmc/hash.............................ok t/pmc/integer..........................ok t/pmc/io............................... not ok 1 - IO on some invalid types # TODO IO on some invalid types ok 8 # SKIP clone not finished yet not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433 not ok 40 - string read/write handle # TODO no stringhandle yet ok t/pmc/io_iterator...................... not ok 1 - new # TODO not yet implemented not ok 2 - shift # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented ok t/pmc/io_status........................ not ok 1 - new # TODO not yet implemented not ok 2 - get_integer (vtable) # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented not ok 4 - return # TODO not yet implemented not ok 5 - error # TODO not yet implemented not ok 6 - throw # TODO not yet implemented ok t/pmc/iterator......................... ok 13 # SKIP N/Y: length of rest of array not ok 16 - adding keys during iteration # TODO adding keys during iteration not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points' ok t/pmc/key.............................. not ok 10 # TODO register and non-register string keys should be COW (RT #60128) ok t/pmc/lexinfo..........................ok t/pmc/lexpad...........................ok t/pmc/managedstruct....................ok t/pmc/multidispatch.................... not ok 22 - MMD on PMC types - Any # TODO RT #41374 not ok 25 - add as method - inherited # TODO RT #41374 not ok 32 - use a core func for an object # TODO RT #59628 ok t/pmc/multisub.........................ok t/pmc/namespace........................ not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17 ok t/pmc/nci..............................ok t/pmc/null.............................ok t/pmc/object-meths..................... ok 14 # SKIP currently broken ok 25 # SKIP no bound NCI method ok t/pmc/object-mro.......................ok t/pmc/object...........................ok t/pmc/objects..........................ok t/pmc/orderedhash......................ok t/pmc/os...............................ok t/pmc/packfile.........................ok t/pmc/packfileconstanttable............ not ok 3 - get_type, get_*_keyed_int # TODO See TT #385. ok t/pmc/packfiledirectory................ok t/pmc/packfilefixupentry...............ok t/pmc/packfilefixuptable...............ok t/pmc/packfilerawsegment...............ok t/pmc/packfilesegment..................ok t/pmc/parrotclass......................ok t/pmc/parrotinterpreter................ok t/pmc/parrotio......................... not ok 2 - open and close - synchronous # TODO not yet implemented ok 3 # SKIP no asynch calls yet not ok 4 - print, read, and readline - synchronous # TODO not yet implemented not ok 5 - record_separator # TODO not yet implemented not ok 6 - buffer_type # TODO not yet implemented ok t/pmc/parrotlibrary....................ok t/pmc/parrotobject.....................ok t/pmc/parrotrunningthread..............ok t/pmc/parrotthread.....................ok t/pmc/pccmethod_test...................ok t/pmc/pmc..............................ok t/pmc/pmcproxy.........................ok t/pmc/pointer..........................ok t/pmc/prop.............................ok t/pmc/random...........................ok t/pmc/ref..............................ok t/pmc/resizablebooleanarray............ok t/pmc/resizablefloatarray..............ok t/pmc/resizableintegerarray............ok t/pmc/resizablepmcarray................ok t/pmc/resizablestringarray.............ok t/pmc/retcontinuation..................ok t/pmc/ro............................... not ok 8 - ResizablePMCArray -- Recursive # TODO 1 ok t/pmc/role.............................ok t/pmc/scalar........................... ok 1 # SKIP doesn't work yet ok t/pmc/scheduler........................ok t/pmc/schedulermessage.................ok t/pmc/sharedref........................ok t/pmc/signal........................... 1..0 # Skip Signals currently disabled skipped: Signals currently disabled t/pmc/slice............................ not ok 2 - bug with slice bits # TODO parser ok t/pmc/string...........................ok t/pmc/stringhandle..................... ok 3 # SKIP no asynch calls yet not ok 9 - record_separator # TODO not yet implemented ok t/pmc/sub..............................ok t/pmc/sys..............................ok t/pmc/task.............................ok t/pmc/threads.......................... not ok 11 - CLONE_CODE | CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511 not ok 15 - CLONE_CODE|CLONE_GLOBALS|CLONE_HLL|CLONE_LIBRARIES # TODO RT #41373 ok t/pmc/timer............................ok t/pmc/undef............................ok t/pmc/unmanagedstruct..................ok t/oo/attributes........................ok t/oo/composition.......................ok t/oo/inheritance.......................ok t/oo/isa...............................ok t/oo/metamodel......................... not ok 6 # TODO tail attribute has a type not ok 12 # TODO new opcode makes working objects ok t/oo/methods...........................ok t/oo/mro-c3............................ok t/oo/names.............................ok t/oo/new...............................ok t/oo/ops...............................ok t/oo/proxy.............................ok t/oo/subclass..........................ok t/oo/vtableoverride....................ok t/native_pbc/header.................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/native_pbc/integer................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/native_pbc/number.................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/native_pbc/string.................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/dynpmc/dynlexpad..................... not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads ok t/dynpmc/foo........................... ok 6 # SKIP No BigInt Lib configured ok t/dynpmc/gdbmhash...................... 1..0 # Skip No gdbm library available skipped: No gdbm library available t/dynpmc/md2...........................ok t/dynpmc/md4...........................ok t/dynpmc/md5...........................ok t/dynpmc/pair..........................ok t/dynpmc/rational......................ok t/dynpmc/ripemd160.....................ok t/dynpmc/rotest........................ok t/dynpmc/sha...........................ok t/dynpmc/sha1..........................ok t/dynpmc/sha256........................ 1..0 # Skip Too old library skipped: Too old library t/dynpmc/sha512........................ 1..0 # Skip Too old library skipped: Too old library t/dynpmc/subclass_with_pir_method...... not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces ok t/dynpmc/subproxy......................ok t/dynoplibs/dan........................ok t/dynoplibs/myops......................ok t/compilers/pct/complete_workflow......ok t/compilers/pct/past...................ok t/compilers/pct/pct_hllcompiler........ok t/compilers/pct/post...................ok t/compilers/pge/00-basic...............ok t/compilers/pge/02-match...............ok t/compilers/pge/03-optable.............ok t/compilers/pge/04-compile.............ok t/compilers/pge/06-grammar.............ok t/compilers/pge/pge-hs.................ok t/compilers/pge/pge....................ok t/compilers/pge/pge_examples...........ok t/compilers/pge/pge_globs..............ok t/compilers/pge/pge_text...............ok t/compilers/pge/pge_util...............ok t/compilers/pge/p5regex/p5rx........... not ok 116 # TODO [re_tests:116] character class in enumeration not ok 119 # TODO [re_tests:119] character class in enumeration not ok 120 # TODO [re_tests:120] character class in enumeration not ok 123 # TODO [re_tests:123] character class in enumeration not ok 124 # TODO [re_tests:124] character class in enumeration not ok 127 # TODO [re_tests:127] character class in enumeration ok 138 # SKIP [re_tests:138] parser bug ok 139 # SKIP [re_tests:139] broken col 4? ok 143 # SKIP [re_tests:143] bug or error ok 144 # SKIP [re_tests:144] bug or error ok 148 # SKIP [re_tests:148] bug or error ok 149 # SKIP [re_tests:149] bug or error ok 155 # SKIP [re_tests:155] bug or error ok 167 # SKIP [re_tests:167] bug or error not ok 234 # TODO [re_tests:234] unknown reason not ok 235 # TODO [re_tests:235] unknown reason not ok 236 # TODO [re_tests:236] unknown reason not ok 246 # TODO [re_tests:246] unknown reason not ok 247 # TODO [re_tests:247] unknown reason ok 248 # SKIP [re_tests:248] bug or error ok 249 # SKIP [re_tests:249] bug or error ok 252 # SKIP [re_tests:252] bug or error not ok 254 # TODO [re_tests:254] unknown reason not ok 256 # TODO [re_tests:256] unknown reason not ok 257 # TODO [re_tests:257] unknown reason ok 264 # SKIP [re_tests:264] trailing modifiers ok 265 # SKIP [re_tests:265] trailing modifiers ok 266 # SKIP [re_tests:266] trailing modifiers ok 267 # SKIP [re_tests:267] trailing modifiers ok 268 # SKIP [re_tests:268] trailing modifiers ok 269 # SKIP [re_tests:269] trailing modifiers ok 270 # SKIP [re_tests:270] trailing modifiers ok 271 # SKIP [re_tests:271] trailing modifiers ok 272 # SKIP [re_tests:272] trailing modifiers ok 273 # SKIP [re_tests:273] trailing modifiers ok 274 # SKIP [re_tests:274] trailing modifiers ok 275 # SKIP [re_tests:275] trailing modifiers ok 276 # SKIP [re_tests:276] trailing modifiers ok 277 # SKIP [re_tests:277] trailing modifiers ok 278 # SKIP [re_tests:278] trailing modifiers ok 279 # SKIP [re_tests:279] trailing modifiers ok 280 # SKIP [re_tests:280] trailing modifiers ok 281 # SKIP [re_tests:281] trailing modifiers ok 282 # SKIP [re_tests:282] trailing modifiers ok 283 # SKIP [re_tests:283] trailing modifiers ok 284 # SKIP [re_tests:284] trailing modifiers ok 285 # SKIP [re_tests:285] trailing modifiers ok 286 # SKIP [re_tests:286] trailing modifiers ok 287 # SKIP [re_tests:287] trailing modifiers ok 288 # SKIP [re_tests:288] trailing modifiers ok 289 # SKIP [re_tests:289] trailing modifiers ok 290 # SKIP [re_tests:290] trailing modifiers ok 291 # SKIP [re_tests:291] trailing modifiers ok 292 # SKIP [re_tests:292] trailing modifiers ok 293 # SKIP [re_tests:293] trailing modifiers ok 294 # SKIP [re_tests:294] trailing modifiers ok 295 # SKIP [re_tests:295] trailing modifiers ok 296 # SKIP [re_tests:296] trailing modifiers ok 297 # SKIP [re_tests:297] trailing modifiers ok 298 # SKIP [re_tests:298] trailing modifiers ok 299 # SKIP [re_tests:299] trailing modifiers ok 300 # SKIP [re_tests:300] trailing modifiers ok 301 # SKIP [re_tests:301] trailing modifiers ok 302 # SKIP [re_tests:302] trailing modifiers ok 303 # SKIP [re_tests:303] trailing modifiers ok 304 # SKIP [re_tests:304] trailing modifiers ok 305 # SKIP [re_tests:305] trailing modifiers ok 306 # SKIP [re_tests:306] trailing modifiers ok 307 # SKIP [re_tests:307] trailing modifiers ok 308 # SKIP [re_tests:308] bug or error ok 309 # SKIP [re_tests:309] bug or error ok 310 # SKIP [re_tests:310] bug or error ok 311 # SKIP [re_tests:311] trailing modifiers ok 312 # SKIP [re_tests:312] trailing modifiers ok 313 # SKIP [re_tests:313] trailing modifiers ok 314 # SKIP [re_tests:314] trailing modifiers ok 315 # SKIP [re_tests:315] trailing modifiers ok 316 # SKIP [re_tests:316] trailing modifiers ok 317 # SKIP [re_tests:317] trailing modifiers ok 318 # SKIP [re_tests:318] trailing modifiers ok 319 # SKIP [re_tests:319] trailing modifiers ok 320 # SKIP [re_tests:320] trailing modifiers ok 321 # SKIP [re_tests:321] trailing modifiers ok 322 # SKIP [re_tests:322] bug or error ok 323 # SKIP [re_tests:323] bug or error ok 324 # SKIP [re_tests:324] trailing modifiers ok 325 # SKIP [re_tests:325] bug or error ok 326 # SKIP [re_tests:326] trailing modifiers ok 327 # SKIP [re_tests:327] trailing modifiers ok 328 # SKIP [re_tests:328] trailing modifiers ok 329 # SKIP [re_tests:329] trailing modifiers ok 330 # SKIP [re_tests:330] bug or error ok 331 # SKIP [re_tests:331] bug or error ok 332 # SKIP [re_tests:332] trailing modifiers ok 333 # SKIP [re_tests:333] trailing modifiers ok 334 # SKIP [re_tests:334] trailing modifiers ok 335 # SKIP [re_tests:335] trailing modifiers ok 336 # SKIP [re_tests:336] bug or error ok 337 # SKIP [re_tests:337] trailing modifiers ok 338 # SKIP [re_tests:338] trailing modifiers ok 339 # SKIP [re_tests:339] trailing modifiers ok 340 # SKIP [re_tests:340] trailing modifiers ok 341 # SKIP [re_tests:341] trailing modifiers ok 342 # SKIP [re_tests:342] trailing modifiers ok 343 # SKIP [re_tests:343] trailing modifiers ok 344 # SKIP [re_tests:344] trailing modifiers ok 345 # SKIP [re_tests:345] trailing modifiers ok 346 # SKIP [re_tests:346] trailing modifiers ok 347 # SKIP [re_tests:347] bug or error ok 348 # SKIP [re_tests:348] trailing modifiers ok 349 # SKIP [re_tests:349] trailing modifiers ok 350 # SKIP [re_tests:350] trailing modifiers ok 351 # SKIP [re_tests:351] trailing modifiers ok 352 # SKIP [re_tests:352] trailing modifiers ok 353 # SKIP [re_tests:353] trailing modifiers ok 354 # SKIP [re_tests:354] trailing modifiers ok 355 # SKIP [re_tests:355] trailing modifiers ok 356 # SKIP [re_tests:356] trailing modifiers ok 357 # SKIP [re_tests:357] trailing modifiers ok 358 # SKIP [re_tests:358] trailing modifiers ok 359 # SKIP [re_tests:359] trailing modifiers ok 360 # SKIP [re_tests:360] trailing modifiers ok 361 # SKIP [re_tests:361] trailing modifiers ok 362 # SKIP [re_tests:362] trailing modifiers ok 363 # SKIP [re_tests:363] trailing modifiers ok 364 # SKIP [re_tests:364] trailing modifiers ok 365 # SKIP [re_tests:365] trailing modifiers ok 366 # SKIP [re_tests:366] trailing modifiers ok 367 # SKIP [re_tests:367] trailing modifiers ok 368 # SKIP [re_tests:368] trailing modifiers ok 369 # SKIP [re_tests:369] trailing modifiers ok 370 # SKIP [re_tests:370] trailing modifiers ok 371 # SKIP [re_tests:371] trailing modifiers ok 372 # SKIP [re_tests:372] trailing modifiers ok 373 # SKIP [re_tests:373] trailing modifiers ok 374 # SKIP [re_tests:374] trailing modifiers ok 375 # SKIP [re_tests:375] trailing modifiers ok 376 # SKIP [re_tests:376] trailing modifiers ok 377 # SKIP [re_tests:377] trailing modifiers ok 378 # SKIP [re_tests:378] trailing modifiers ok 379 # SKIP [re_tests:379] trailing modifiers ok 380 # SKIP [re_tests:380] trailing modifiers ok 381 # SKIP [re_tests:381] trailing modifiers ok 382 # SKIP [re_tests:382] trailing modifiers ok 383 # SKIP [re_tests:383] trailing modifiers ok 384 # SKIP [re_tests:384] trailing modifiers ok 385 # SKIP [re_tests:385] trailing modifiers ok 386 # SKIP [re_tests:386] trailing modifiers ok 387 # SKIP [re_tests:387] trailing modifiers ok 388 # SKIP [re_tests:388] trailing modifiers ok 389 # SKIP [re_tests:389] trailing modifiers ok 390 # SKIP [re_tests:390] trailing modifiers ok 391 # SKIP [re_tests:391] trailing modifiers ok 392 # SKIP [re_tests:392] trailing modifiers ok 393 # SKIP [re_tests:393] trailing modifiers ok 394 # SKIP [re_tests:394] trailing modifiers ok 395 # SKIP [re_tests:395] trailing modifiers not ok 396 # TODO [re_tests:396] unknown reason not ok 397 # TODO [re_tests:397] unknown reason not ok 398 # TODO [re_tests:398] unknown reason ok 408 # SKIP [re_tests:408] bug or error not ok 419 # TODO [re_tests:419] unknown reason not ok 422 # TODO [re_tests:422] unknown reason not ok 429 # TODO [re_tests:429] unknown reason not ok 432 # TODO [re_tests:432] unknown reason not ok 434 # TODO [re_tests:434] unknown reason not ok 435 # TODO [re_tests:435] unknown reason ok 436 # SKIP [re_tests:436] bug or error not ok 439 # TODO [re_tests:439] unknown reason not ok 446 # TODO [re_tests:446] unknown reason not ok 447 # TODO [re_tests:447] unknown reason not ok 448 # TODO [re_tests:448] unknown reason not ok 449 # TODO [re_tests:449] unknown reason not ok 452 # TODO [re_tests:452] unknown reason not ok 453 # TODO [re_tests:453] unknown reason not ok 454 # TODO [re_tests:454] unknown reason not ok 455 # TODO [re_tests:455] unknown reason ok 458 # SKIP [re_tests:458] unknown reason ok 459 # SKIP [re_tests:459] unknown reason ok 460 # SKIP [re_tests:460] unknown reason ok 461 # SKIP [re_tests:461] unknown reason ok 462 # SKIP [re_tests:462] unknown reason ok 463 # SKIP [re_tests:463] unknown reason ok 464 # SKIP [re_tests:464] unknown reason ok 465 # SKIP [re_tests:465] unknown reason ok 466 # SKIP [re_tests:466] unknown reason ok 467 # SKIP [re_tests:467] unknown reason ok 468 # SKIP [re_tests:468] unknown reason ok 469 # SKIP [re_tests:469] unknown reason ok 470 # SKIP [re_tests:470] unknown reason ok 471 # SKIP [re_tests:471] unknown reason ok 472 # SKIP [re_tests:472] unknown reason ok 473 # SKIP [re_tests:473] unknown reason ok 474 # SKIP [re_tests:474] unknown reason ok 475 # SKIP [re_tests:475] unknown reason ok 476 # SKIP [re_tests:476] unknown reason ok 477 # SKIP [re_tests:477] unknown reason ok 478 # SKIP [re_tests:478] unknown reason ok 479 # SKIP [re_tests:479] unknown reason ok 480 # SKIP [re_tests:480] unknown reason ok 483 # SKIP [re_tests:483] ok 484 # SKIP [re_tests:484] ok 487 # SKIP [re_tests:487] bug or error ok 488 # SKIP [re_tests:488] bug or error ok 489 # SKIP [re_tests:489] bug or error ok 490 # SKIP [re_tests:490] bug or error ok 491 # SKIP [re_tests:491] kills a parrot ok 492 # SKIP [re_tests:492] bug or error ok 493 # SKIP [re_tests:493] kills a parrot not ok 495 # TODO [re_tests:495] unknown reason ok 496 # SKIP [re_tests:496] not ok 498 # TODO [re_tests:498] unknown reason not ok 500 # TODO [re_tests:500] unknown reason not ok 501 # TODO [re_tests:501] unknown reason ok 502 # SKIP [re_tests:502] unknown reason not ok 503 # TODO [re_tests:503] unknown reason not ok 504 # TODO [re_tests:504] unknown reason not ok 505 # TODO [re_tests:505] unknown reason not ok 506 # TODO [re_tests:506] unknown reason not ok 507 # TODO [re_tests:507] unknown reason not ok 508 # TODO [re_tests:508] unknown reason not ok 509 # TODO [re_tests:509] unknown reason not ok 510 # TODO [re_tests:510] unknown reason not ok 511 # TODO [re_tests:511] unknown reason not ok 512 # TODO [re_tests:512] unknown reason not ok 515 # TODO [re_tests:515] unknown reason not ok 521 # TODO [re_tests:521] unknown reason not ok 522 # TODO [re_tests:522] unknown reason not ok 523 # TODO [re_tests:523] unknown reason not ok 524 # TODO [re_tests:524] unknown reason not ok 527 # TODO [re_tests:527] unknown reason not ok 528 # TODO [re_tests:528] unknown reason ok 531 # SKIP [re_tests:531] bug or error ok 532 # SKIP [re_tests:532] bug or error not ok 535 # TODO [re_tests:535] unknown reason not ok 536 # TODO [re_tests:536] unknown reason not ok 539 # TODO [re_tests:539] unknown reason not ok 540 # TODO [re_tests:540] unknown reason not ok 541 # TODO [re_tests:541] unknown reason not ok 544 # TODO [re_tests:544] unknown reason not ok 545 # TODO [re_tests:545] unknown reason ok 556 # SKIP [re_tests:556] kills a parrot ok 557 # SKIP [re_tests:557] kills a parrot not ok 559 # TODO [re_tests:559] unknown reason ok 563 # SKIP [re_tests:563] bug or error ok 564 # SKIP [re_tests:564] bug or error ok 566 # SKIP [re_tests:566] bug or error ok 568 # SKIP [re_tests:568] kills a parrot ok 569 # SKIP [re_tests:569] kills a parrot ok 570 # SKIP [re_tests:570] kills a parrot ok 571 # SKIP [re_tests:571] kills a parrot ok 572 # SKIP [re_tests:572] kills a parrot ok 573 # SKIP [re_tests:573] kills a parrot ok 574 # SKIP [re_tests:574] kills a parrot ok 575 # SKIP [re_tests:575] kills a parrot ok 576 # SKIP [re_tests:576] kills a parrot ok 577 # SKIP [re_tests:577] kills a parrot ok 578 # SKIP [re_tests:578] kills a parrot ok 579 # SKIP [re_tests:579] kills a parrot ok 580 # SKIP [re_tests:580] kills a parrot ok 581 # SKIP [re_tests:581] kills a parrot ok 582 # SKIP [re_tests:582] kills a parrot ok 583 # SKIP [re_tests:583] kills a parrot ok 584 # SKIP [re_tests:584] kills a parrot ok 585 # SKIP [re_tests:585] kills a parrot ok 586 # SKIP [re_tests:586] kills a parrot ok 587 # SKIP [re_tests:587] kills a parrot ok 588 # SKIP [re_tests:588] kills a parrot ok 589 # SKIP [re_tests:589] kills a parrot ok 590 # SKIP [re_tests:590] kills a parrot ok 591 # SKIP [re_tests:591] kills a parrot ok 592 # SKIP [re_tests:592] kills a parrot ok 593 # SKIP [re_tests:593] bug or error ok 594 # SKIP [re_tests:594] bug or error not ok 595 # TODO [re_tests:595] unknown reason not ok 596 # TODO [re_tests:596] unknown reason ok 597 # SKIP [re_tests:597] unknown reason ok 598 # SKIP [re_tests:598] bug or error ok 599 # SKIP [re_tests:599] bug or error not ok 600 # TODO [re_tests:600] unknown reason not ok 601 # TODO [re_tests:601] unknown reason not ok 603 # TODO [re_tests:603] unknown reason not ok 604 # TODO [re_tests:604] unknown reason not ok 606 # TODO [re_tests:606] unknown reason not ok 607 # TODO [re_tests:607] unknown reason ok 609 # SKIP [re_tests:609] unknown reason ok 610 # SKIP [re_tests:610] unknown reason ok 611 # SKIP [re_tests:611] unknown reason ok 612 # SKIP [re_tests:612] unknown reason ok 613 # SKIP [re_tests:613] unknown reason ok 614 # SKIP [re_tests:614] unknown reason ok 615 # SKIP [re_tests:615] unknown reason ok 616 # SKIP [re_tests:616] unknown reason ok 617 # SKIP [re_tests:617] unknown reason not ok 621 # TODO [re_tests:621] unknown reason not ok 623 # TODO [re_tests:623] unknown reason not ok 624 # TODO [re_tests:624] unknown reason not ok 625 # TODO [re_tests:625] unknown reason ok 627 # SKIP [re_tests:627] unknown reason ok 628 # SKIP [re_tests:628] unknown reason ok 629 # SKIP [re_tests:629] unknown reason ok 630 # SKIP [re_tests:630] unknown reason ok 631 # SKIP [re_tests:631] unknown reason ok 632 # SKIP [re_tests:632] unknown reason ok 633 # SKIP [re_tests:633] unknown reason ok 634 # SKIP [re_tests:634] unknown reason ok 635 # SKIP [re_tests:635] unknown reason not ok 639 # TODO [re_tests:639] unknown reason not ok 641 # TODO [re_tests:641] unknown reason not ok 642 # TODO [re_tests:642] unknown reason not ok 643 # TODO [re_tests:643] unknown reason ok 645 # SKIP [re_tests:645] unknown reason ok 646 # SKIP [re_tests:646] unknown reason ok 647 # SKIP [re_tests:647] unknown reason ok 648 # SKIP [re_tests:648] unknown reason ok 649 # SKIP [re_tests:649] unknown reason ok 650 # SKIP [re_tests:650] unknown reason ok 651 # SKIP [re_tests:651] unknown reason ok 652 # SKIP [re_tests:652] unknown reason ok 653 # SKIP [re_tests:653] unknown reason ok 663 # SKIP [re_tests:663] unknown reason ok 664 # SKIP [re_tests:664] unknown reason ok 665 # SKIP [re_tests:665] unknown reason ok 666 # SKIP [re_tests:666] unknown reason ok 667 # SKIP [re_tests:667] unknown reason ok 668 # SKIP [re_tests:668] unknown reason ok 669 # SKIP [re_tests:669] unknown reason ok 670 # SKIP [re_tests:670] unknown reason ok 671 # SKIP [re_tests:671] unknown reason ok 681 # SKIP [re_tests:681] unknown reason ok 682 # SKIP [re_tests:682] unknown reason ok 683 # SKIP [re_tests:683] unknown reason ok 684 # SKIP [re_tests:684] unknown reason ok 685 # SKIP [re_tests:685] unknown reason ok 686 # SKIP [re_tests:686] unknown reason ok 687 # SKIP [re_tests:687] unknown reason ok 688 # SKIP [re_tests:688] unknown reason ok 689 # SKIP [re_tests:689] unknown reason not ok 693 # TODO [re_tests:693] unknown reason not ok 695 # TODO [re_tests:695] unknown reason not ok 696 # TODO [re_tests:696] unknown reason not ok 697 # TODO [re_tests:697] unknown reason ok 699 # SKIP [re_tests:699] unknown reason ok 700 # SKIP [re_tests:700] unknown reason ok 701 # SKIP [re_tests:701] unknown reason ok 702 # SKIP [re_tests:702] unknown reason ok 703 # SKIP [re_tests:703] unknown reason ok 704 # SKIP [re_tests:704] unknown reason ok 705 # SKIP [re_tests:705] unknown reason ok 706 # SKIP [re_tests:706] unknown reason ok 707 # SKIP [re_tests:707] unknown reason ok 717 # SKIP [re_tests:717] unknown reason ok 718 # SKIP [re_tests:718] unknown reason ok 719 # SKIP [re_tests:719] unknown reason ok 720 # SKIP [re_tests:720] unknown reason ok 721 # SKIP [re_tests:721] unknown reason ok 722 # SKIP [re_tests:722] unknown reason ok 723 # SKIP [re_tests:723] unknown reason ok 724 # SKIP [re_tests:724] unknown reason ok 725 # SKIP [re_tests:725] unknown reason ok 735 # SKIP [re_tests:735] unknown reason ok 736 # SKIP [re_tests:736] unknown reason ok 737 # SKIP [re_tests:737] unknown reason ok 738 # SKIP [re_tests:738] unknown reason ok 739 # SKIP [re_tests:739] unknown reason ok 740 # SKIP [re_tests:740] unknown reason ok 741 # SKIP [re_tests:741] unknown reason ok 742 # SKIP [re_tests:742] unknown reason ok 743 # SKIP [re_tests:743] unknown reason not ok 747 # TODO [re_tests:747] unknown reason not ok 749 # TODO [re_tests:749] unknown reason not ok 750 # TODO [re_tests:750] unknown reason not ok 751 # TODO [re_tests:751] unknown reason ok 753 # SKIP [re_tests:753] unknown reason ok 754 # SKIP [re_tests:754] unknown reason ok 755 # SKIP [re_tests:755] unknown reason ok 756 # SKIP [re_tests:756] unknown reason ok 757 # SKIP [re_tests:757] unknown reason ok 758 # SKIP [re_tests:758] unknown reason ok 759 # SKIP [re_tests:759] unknown reason ok 760 # SKIP [re_tests:760] unknown reason ok 761 # SKIP [re_tests:761] unknown reason ok 771 # SKIP [re_tests:771] unknown reason ok 772 # SKIP [re_tests:772] unknown reason ok 773 # SKIP [re_tests:773] unknown reason ok 774 # SKIP [re_tests:774] unknown reason ok 775 # SKIP [re_tests:775] unknown reason ok 776 # SKIP [re_tests:776] unknown reason ok 777 # SKIP [re_tests:777] unknown reason ok 778 # SKIP [re_tests:778] unknown reason ok 779 # SKIP [re_tests:779] unknown reason ok 789 # SKIP [re_tests:789] unknown reason ok 790 # SKIP [re_tests:790] unknown reason ok 791 # SKIP [re_tests:791] unknown reason ok 792 # SKIP [re_tests:792] unknown reason ok 793 # SKIP [re_tests:793] unknown reason ok 794 # SKIP [re_tests:794] unknown reason ok 795 # SKIP [re_tests:795] unknown reason ok 796 # SKIP [re_tests:796] unknown reason ok 797 # SKIP [re_tests:797] unknown reason ok 800 # SKIP [re_tests:800] not ok 801 # TODO [re_tests:801] unknown reason ok 802 # SKIP [re_tests:802] ok 803 # SKIP [re_tests:803] ok 805 # SKIP [re_tests:805] ok 806 # SKIP [re_tests:806] hangs a parrot ok 807 # SKIP [re_tests:807] hangs a parrot ok 808 # SKIP [re_tests:808] hangs a parrot ok 809 # SKIP [re_tests:809] hangs a parrot ok 810 # SKIP [re_tests:810] hangs a parrot ok 811 # SKIP [re_tests:811] hangs a parrot ok 812 # SKIP [re_tests:812] hangs a parrot ok 813 # SKIP [re_tests:813] hangs a parrot ok 814 # SKIP [re_tests:814] hangs a parrot ok 815 # SKIP [re_tests:815] hangs a parrot ok 816 # SKIP [re_tests:816] hangs a parrot ok 817 # SKIP [re_tests:817] hangs a parrot ok 818 # SKIP [re_tests:818] hangs a parrot ok 819 # SKIP [re_tests:819] hangs a parrot ok 820 # SKIP [re_tests:820] hangs a parrot ok 821 # SKIP [re_tests:821] hangs a parrot ok 822 # SKIP [re_tests:822] hangs a parrot ok 823 # SKIP [re_tests:823] hangs a parrot not ok 827 # TODO [re_tests:827] \d in character class ok 828 # SKIP [re_tests:828] ok 829 # SKIP [re_tests:829] ok 830 # SKIP [re_tests:830] ok 834 # SKIP [re_tests:834] ok 835 # SKIP [re_tests:835] ok 836 # SKIP [re_tests:836] ok 838 # SKIP [re_tests:838] not ok 858 # TODO [re_tests:858] unknown reason ok 859 # SKIP [re_tests:859] ok 862 # SKIP [re_tests:862] not ok 865 # TODO [re_tests:865] unknown reason not ok 866 # TODO [re_tests:866] unknown reason ok 877 # SKIP [re_tests:877] ok 879 # SKIP [re_tests:879] [ID 20010811.006] not ok 881 # TODO [re_tests:881] unknown reason ok 886 # SKIP [re_tests:886] not ok 887 # TODO [re_tests:887] unknown reason not ok 888 # TODO [re_tests:888] unknown reason not ok 890 # TODO [re_tests:890] unknown reason not ok 891 # TODO [re_tests:891] unknown reason not ok 893 # TODO [re_tests:893] unknown reason not ok 896 # TODO [re_tests:896] unknown reason not ok 897 # TODO [re_tests:897] unknown reason not ok 898 # TODO [re_tests:898] unknown reason not ok 899 # TODO [re_tests:899] unknown reason not ok 901 # TODO [re_tests:901] greediness/lookbehind not ok 904 # TODO [re_tests:904] greediness/lookbehind not ok 905 # TODO [re_tests:905] greediness/lookbehind not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion not ok 915 # TODO [re_tests:915] non-greedy/lookbehind not ok 916 # TODO [re_tests:916] non-greedy/lookbehind not ok 918 # TODO [re_tests:918] non-greedy/lookbehind not ok 921 # TODO [re_tests:921] non-greedy/lookbehind not ok 922 # TODO [re_tests:922] non-greedy/lookbehind not ok 923 # TODO [re_tests:923] unmatched bracket ok 924 # SKIP [re_tests:924] ok 926 # SKIP [re_tests:926] [perl #18019] not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171] not ok 928 # TODO [re_tests:928] reuse captured group not ok 929 # TODO [re_tests:929] reuse captured group not ok 930 # TODO [re_tests:930] reuse captured group not ok 931 # TODO [re_tests:931] reuse captured group not ok 932 # TODO [re_tests:932] reuse captured group not ok 933 # TODO [re_tests:933] reuse captured group not ok 934 # TODO [re_tests:934] reuse captured group not ok 935 # TODO [re_tests:935] reuse captured group not ok 936 # TODO [re_tests:936] reuse captured group not ok 937 # TODO [re_tests:937] reuse captured group not ok 938 # TODO [re_tests:938] reuse captured group not ok 939 # TODO [re_tests:939] reuse captured group not ok 940 # TODO [re_tests:940] reuse captured group not ok 941 # TODO [re_tests:941] reuse captured group not ok 942 # TODO [re_tests:942] reuse captured group ok 944 # SKIP [re_tests:944] unknown reason ok 945 # SKIP [re_tests:945] unknown reason ok 957 # SKIP [re_tests:957] ok 958 # SKIP [re_tests:958] not ok 959 # TODO [re_tests:959] [perl #34195] not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion ok t/compilers/pge/perl6regex/01-regex.... not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&|) - parse error not ok 99 # TODO [rx_metachars:114] null pattern invalid not ok 386 # TODO [rx_backtrack:4] basic not ok 427 # TODO [rx_charclass:26] illegal character range not ok 458 # TODO [rx_charclass:62] literal match (\") not ok 459 # TODO [rx_charclass:64] literal match (\") not ok 460 # TODO [rx_charclass:66] literal match with quote not ok 461 # TODO [rx_charclass:68] literal match with quote not ok 462 # TODO [rx_charclass:70] literal match with backslash not ok 463 # TODO [rx_charclass:72] literal match with interpolation not ok 464 # TODO [rx_charclass:74] literal match with interpolation not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i) not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s) not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s) not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s) not ok 709 # TODO [rx_modifiers:131] basic ws match not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5) not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth) not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth) ok t/compilers/pge/perl6regex/context..... not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented ok t/compilers/tge/basic..................ok t/compilers/tge/grammar................ not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug ok t/compilers/tge/parser.................ok t/library/cgi_query_hash...............ok t/library/coroutine....................ok t/library/dumper.......................ok t/library/getopt_obj...................ok t/library/hllmacros....................ok t/library/iter.........................ok t/library/md5..........................ok t/library/mime_base64..................ok t/library/mt19937ar....................ok t/library/p6object..................... not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) > ok t/library/parrotlib....................ok t/library/pcre......................... ok 1 # SKIP no pcre-config ok t/library/pg........................... ok 1 # SKIP skipped ok 2 # SKIP skipped ok 3 # SKIP skipped ok 4 # SKIP skipped ok 5 # SKIP skipped ok 6 # SKIP skipped ok 7 # SKIP skipped ok 8 # SKIP skipped ok 9 # SKIP skipped ok 10 # SKIP skipped ok 11 # SKIP skipped ok 12 # SKIP skipped ok 13 # SKIP skipped ok 14 # SKIP skipped ok 15 # SKIP skipped ok 16 # SKIP skipped ok 17 # SKIP skipped ok 18 # SKIP skipped ok 19 # SKIP skipped ok 20 # SKIP skipped ok 21 # SKIP skipped ok 22 # SKIP skipped ok 23 # SKIP skipped ok 24 # SKIP skipped ok 25 # SKIP skipped ok 26 # SKIP skipped ok 27 # SKIP skipped ok 28 # SKIP skipped ok 29 # SKIP skipped ok 30 # SKIP skipped ok 31 # SKIP skipped ok 32 # SKIP skipped ok 33 # SKIP skipped ok 34 # SKIP skipped ok 35 # SKIP skipped ok 36 # SKIP skipped ok 37 # SKIP skipped ok 38 # SKIP skipped ok 39 # SKIP skipped ok 40 # SKIP skipped ok 41 # SKIP skipped ok 42 # SKIP skipped ok 43 # SKIP skipped ok t/library/protoobject..................ok t/library/rand.........................ok t/library/range........................ok t/library/streams...................... ok 18 # SKIP broken method invocation ok 20 # SKIP broken method invocation ok t/library/string_utils.................ok t/library/tcl_glob.....................ok t/library/tcl_lib......................ok t/library/test_builder_tester..........ok t/library/test_class...................ok t/library/test_more....................ok t/library/uuid.........................ok t/library/yaml_dumper.................. not ok 7 - properties # TODO not yet implemented not ok 8 - indent string # TODO not supported not ok 9 - back-referencing properties # TODO not yet implemented not ok 10 - self-referential properties (1) # TODO not yet implemented not ok 11 - self-referential properties (2) # TODO not yet implemented not ok 26 - custom dumper # TODO not yet implemented ok t/library/yaml_parser_syck............. not ok 1 - basic parsing # TODO Not properly implemented yet ok All tests successful. Files=252, Tests=8326, 418 wallclock secs ( 5.94 usr 4.03 sys + 184.52 cusr 111.58 csys = 306.07 CPU) Result: PASS perl t/harness --gc-debug --running-make-test -g --runcore-tests t/compilers/imcc/imcpasm/cfg...........ok t/compilers/imcc/imcpasm/opt0.......... ok 1 # SKIP disabled graph coloring register allocator, RT #57028 ok 3 # SKIP disabled graph coloring register allocator, RT #57028 ok t/compilers/imcc/imcpasm/opt1.......... ok 76 # SKIP constant concat N/Y ok t/compilers/imcc/imcpasm/opt2.......... ok 5 # SKIP loop opt disabled for now ok t/compilers/imcc/imcpasm/optc.......... not ok 9 - tailcall 1 # TODO RT #57028 ok t/compilers/imcc/imcpasm/pcc...........ok t/compilers/imcc/imcpasm/sub...........ok t/compilers/imcc/reg/alloc.............ok t/compilers/imcc/reg/spill.............ok t/compilers/imcc/syn/bsr...............ok t/compilers/imcc/syn/clash............. not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet ok t/compilers/imcc/syn/const.............ok t/compilers/imcc/syn/errors............ok t/compilers/imcc/syn/eval.............. ok 1 # SKIP changed eval semantics - see t/pmc/eval.t ok 2 # SKIP changed eval semantics - see t/pmc/eval.t ok 3 # SKIP changed eval semantics - see t/pmc/eval.t ok 4 # SKIP changed eval semantics - see t/pmc/eval.t ok 5 # SKIP changed eval semantics - see t/pmc/eval.t ok 6 # SKIP changed eval semantics - see t/pmc/eval.t ok 7 # SKIP changed eval semantics - see t/pmc/eval.t ok t/compilers/imcc/syn/file.............. ok 13 # SKIP multiple loading not speced - failing ok t/compilers/imcc/syn/hll...............ok t/compilers/imcc/syn/keyed............. ok 1 # SKIP experimental ok t/compilers/imcc/syn/labels............ok t/compilers/imcc/syn/macro............. not ok 25 - unterminated macro 2 # TODO Darwin segfault -- RT #60926 ok t/compilers/imcc/syn/objects...........ok t/compilers/imcc/syn/op................ok t/compilers/imcc/syn/pasm..............ok t/compilers/imcc/syn/pcc...............ok t/compilers/imcc/syn/pod............... ok 4 # SKIP Closing out of pod from included files ok t/compilers/imcc/syn/regressions....... not ok 4 - comments between .param(RT \#46499) # TODO broken not ok 6 - whitespace between .param(RT \#46499) # TODO broken not ok 7 - off by one error message (RT \#40204) # TODO broken ok t/compilers/imcc/syn/scope.............ok t/compilers/imcc/syn/subflags.......... not ok 15 # TODO :method sub not found in namespace ok t/compilers/imcc/syn/symbols...........ok t/compilers/imcc/syn/tail..............ok t/compilers/imcc/syn/veracity..........ok t/op/00ff-dos..........................ok t/op/00ff-unix.........................ok t/op/01-parse_ops......................ok t/op/64bit............................. 1..0 # Skip 64bit INTVAL platforms only skipped: 64bit INTVAL platforms only t/op/annotate..........................ok t/op/arithmetics....................... ok 28 # SKIP No integer overflow for 32-bit INTVALs without GMP installed ok t/op/basic.............................ok t/op/bitwise........................... ok 27 # SKIP no BigInt lib found ok t/op/box...............................ok t/op/calling........................... not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all not ok 93 - arg mismatch with no params # TODO RT #39844 ok t/op/cc_params.........................ok t/op/cc_state.......................... not ok 6 - positional found, named expected # TODO cc processor state missing not ok 8 - G2: argument underflow: required slurpy param # TODO failing ok t/op/cmp-nonbranch.....................ok t/op/comp..............................ok t/op/copy..............................ok t/op/debuginfo......................... ok 1 # SKIP disabled on fast-core ok 7 # SKIP disabled on this core ok 8 # SKIP disabled on this core ok t/op/exceptions........................ not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans ok t/op/gc................................ok t/op/globals...........................ok t/op/hacks............................. ok 1 # SKIP no universal SIGFPE handling ok 2 # SKIP no universal SIGFPE handling ok t/op/ifunless..........................ok t/op/integer...........................ok t/op/interp............................ ok 1 # SKIP we really shouldn't run just a label - use a sub ok t/op/io................................ok t/op/jit...............................ok t/op/jitn..............................ok t/op/lexicals.......................... not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented ok t/op/literal...........................ok t/op/load_bytecode.....................ok t/op/number............................ok t/op/pushaction........................ not ok 7 - pushaction: error while handling error # TODO runloop shenanigans ok t/op/say...............................ok t/op/spawnw............................ok t/op/sprintf........................... ok 5 # SKIP parrot extension (%B) ok 7 # SKIP perl5-specific extension (%D) ok 9 # SKIP perl5-specific extension (%F) ok 16 # SKIP parrot extension (%H) ok 20 # SKIP parrot extension (%L) ok 23 # SKIP perl5-specific extension (%O) ok 24 # SKIP parrot extension (%P) ok 27 # SKIP parrot extension (%S) ok 29 # SKIP perl5-specific extension (%U) not ok 64 # TODO [%03.2d] actual: > 01< ok 71 # SKIP perl5-specific extension (%v...) ok 72 # SKIP perl5-specific extension (%v...) ok 73 # SKIP perl5-specific extension (%v...) ok 74 # SKIP perl5-specific extension (%v...) ok 75 # SKIP perl5-specific extension (%v...) ok 76 # SKIP perl5-specific extension (%v...) ok 77 # SKIP perl5-specific extension (%v...) ok 78 # SKIP perl5-specific extension (%v...) ok 79 # SKIP perl5-specific extension (%v...) ok 80 # SKIP perl5-specific extension (%v...) ok 81 # SKIP perl5-specific extension (%v...) ok 82 # SKIP perl5-specific extension (%v...) ok 83 # SKIP perl5-specific extension (%v...) ok 84 # SKIP perl5-specific extension (%v...) ok 85 # SKIP perl5-specific extension (%v...) ok 86 # SKIP perl5-specific extension (%v...) ok 87 # SKIP perl5-specific extension (%v...) ok 88 # SKIP perl5-specific extension (%v...) ok 89 # SKIP perl5-specific extension (%v...) ok 90 # SKIP perl5-specific extension (%v...) ok 91 # SKIP perl5-specific extension (%v...) ok 92 # SKIP perl5-specific extension (%v...) ok 93 # SKIP perl5-specific extension (%v...) ok 94 # SKIP perl5-specific extension (%v...) ok 95 # SKIP perl5-specific extension (%v...) ok 96 # SKIP perl5-specific extension (%v...) ok 97 # SKIP perl5-specific extension (%v...) ok 98 # SKIP perl5-specific extension (%v...) ok 99 # SKIP perl5-specific extension (%v...) ok 114 # SKIP harness needs support for * modifier ok 131 # SKIP harness needs support for * modifier ok 141 # SKIP harness needs support for * modifier ok 144 # SKIP perl5 expresssion as test value not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1< ok 161 # SKIP harness needs support for * modifier ok 166 # SKIP harness needs support for * modifier not ok 187 # TODO [%h] actual: >< not ok 191 # TODO [%l] actual: >< ok 193 # SKIP perl5-specific test ok 200 # SKIP perl5-specific test ok 201 # SKIP perl5-specific test ok 202 # SKIP parrot extension (%p) ok 204 # SKIP parrot extension (%r) ok 210 # SKIP harness needs support for * modifier ok 214 # SKIP harness needs support for * modifier not ok 223 # TODO [%v] actual: >< ok 233 # SKIP harness needs support for * modifier ok 234 # SKIP perl5-specific extension (%v...) ok 235 # SKIP perl5-specific extension (%v...) ok 238 # SKIP perl5-specific test ok 239 # SKIP perl5-specific test ok 240 # SKIP perl5-specific test ok 241 # SKIP perl5-specific test ok 242 # SKIP perl5-specific test ok 243 # SKIP perl5-specific test ok 244 # SKIP perl5-specific test ok 245 # SKIP perl5-specific test ok 246 # SKIP perl5-specific test ok 247 # SKIP perl5-specific test ok 248 # SKIP perl5-specific test ok 249 # SKIP perl5-specific test ok 250 # SKIP perl5-specific test ok 251 # SKIP perl5-specific test ok 252 # SKIP perl5-specific extension (%v...) ok 253 # SKIP perl5-specific extension (%v...) ok 254 # SKIP perl5-specific extension (%v...) ok 255 # SKIP perl5-specific extension (%v...) ok 256 # SKIP perl5-specific extension (%v...) ok 257 # SKIP perl5-specific extension (%v...) ok 258 # SKIP perl5-specific extension (%v...) ok 259 # SKIP perl5-specific extension (%v...) ok 260 # SKIP perl5-specific extension (%v...) ok 261 # SKIP perl5-specific extension (%v...) ok 262 # SKIP perl5-specific extension (%v...) ok 263 # SKIP perl5-specific extension (%v...) ok 264 # SKIP perl5-specific extension (%v...) ok 265 # SKIP perl5-specific extension (%v...) ok 266 # SKIP perl5-specific extension (%v...) ok 267 # SKIP perl5-specific extension (%v...) ok 268 # SKIP perl5-specific extension (%v...) ok 269 # SKIP perl5-specific extension (%v...) ok 270 # SKIP perl5-specific extension (%v...) ok 271 # SKIP perl5-specific extension (%v...) ok 272 # SKIP perl5-specific extension (%v...) ok 273 # SKIP perl5-specific extension (%v...) ok 274 # SKIP perl5-specific extension (%v...) ok 275 # SKIP perl5-specific extension (%v...) ok 276 # SKIP perl5-specific extension (%v...) ok 277 # SKIP perl5-specific extension (%v...) ok 278 # SKIP perl5-specific extension (%v...) ok 279 # SKIP perl5-specific extension (%v...) ok 280 # SKIP perl5-specific extension (%v...) ok 281 # SKIP perl5-specific extension (%v...) ok 282 # SKIP perl5-specific extension (%v...) ok 283 # SKIP perl5-specific extension (%v...) ok 284 # SKIP perl5-specific extension (%v...) ok 285 # SKIP perl5-specific extension (%v...) ok 286 # SKIP perl5-specific extension (%v...) ok 287 # SKIP perl5-specific extension (%v...) ok 288 # SKIP perl5-specific extension (%v...) ok 289 # SKIP perl5-specific extension (%v...) ok 290 # SKIP perl5-specific extension (%v...) ok 291 # SKIP perl5-specific extension (%v...) ok 292 # SKIP perl5-specific extension (%v...) ok 293 # SKIP perl5-specific extension (%v...) ok 294 # SKIP perl5-specific extension (%v...) ok 295 # SKIP perl5-specific extension (%v...) ok 296 # SKIP perl5-specific extension (%v...) ok 297 # SKIP perl5-specific extension (%v...) ok 298 # SKIP perl5-specific extension (%v...) ok 300 # SKIP harness needs support for * modifier not ok 304 # TODO [%#b] actual: >0b0< not ok 305 # TODO [%#o] actual: >00< not ok 306 # TODO [%#x] actual: >0x0< ok 307 # SKIP perl5-specific extension (%v...) ok 308 # SKIP perl5-specific extension (%v...) ok t/op/sprintf2..........................ok t/op/string............................ ok 103 # SKIP Pending rework of creating non-ascii literals ok 104 # SKIP Pending rework of creating non-ascii literals ok 118 # SKIP Pending reimplementation of find_encoding ok 119 # SKIP no more visible encoding ok 137 # SKIP No unicode yet ok 139 # SKIP no more transcode ok 140 # SKIP no more chartype ok t/op/string_cclass..................... ok 7 # SKIP unicode support unavailable ok 8 # SKIP unicode support unavailable ok 9 # SKIP unicode support unavailable ok t/op/string_cs......................... ok 31 # SKIP no ICU lib ok 32 # SKIP no ICU lib ok 33 # SKIP no ICU lib ok 34 # SKIP no ICU lib ok 35 # SKIP no ICU lib ok 36 # SKIP no ICU lib ok 37 # SKIP no ICU lib ok 38 # SKIP no ICU lib ok 39 # SKIP no ICU lib ok 40 # SKIP no ICU lib ok 41 # SKIP no ICU lib ok 42 # SKIP no ICU lib ok 43 # SKIP no ICU lib ok 44 # SKIP no ICU lib ok 45 # SKIP no ICU lib ok 46 # SKIP no ICU lib ok t/op/string_mem........................ok t/op/stringu........................... ok 20 # SKIP no ICU lib ok 21 # SKIP no ICU lib ok 22 # SKIP no ICU lib ok 25 # SKIP Tests seem to fail on big endian machines with icu ok 26 # SKIP Tests seem to fail on big endian machines with icu not ok 27 - UTF-8 and Unicode literals # TODO TT #24 ok t/op/sysinfo........................... not ok 11 - sysinfo OS version string # TODO Not Currently Implemented not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented ok 13 # SKIP Requires a lot of work to find out the correct answer ok 14 # SKIP Testing only in some known platforms ok t/op/time..............................ok t/op/trans.............................ok t/pmc/addrregistry.....................ok t/pmc/array............................ not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken ok t/pmc/bigint........................... 1..0 # Skip No BigInt Lib configured skipped: No BigInt Lib configured t/pmc/bignum........................... 1..0 # Skip No BigNum PMC enabled skipped: No BigNum PMC enabled t/pmc/boolean..........................ok t/pmc/bound_nci........................ok t/pmc/callsignature....................ok t/pmc/capture..........................ok t/pmc/class............................ not ok 28 # TODO add_method() invoking method added to class works ok t/pmc/codestring.......................ok t/pmc/complex.......................... ok 58 # SKIP div by zero not caught ok 59 # SKIP div by zero not caught ok 60 # SKIP div by zero not caught ok 86 # SKIP instantiate n/y ok 87 # SKIP instantiate n/y ok 88 # SKIP instantiate n/y ok 89 # SKIP instantiate n/y ok 126 # SKIP inf is not platform-independent ok 465 # SKIP add using subclass of Complex - RT #59630 ok 466 # SKIP add using subclass of Complex - RT #59630 ok 467 # SKIP add using subclass of Complex - RT #59630 ok t/pmc/config...........................ok t/pmc/continuation.....................ok t/pmc/coroutine........................ not ok 9 - Call an exited coroutine # TODO goes one iteration too far. ok t/pmc/cpointer.........................ok t/pmc/default.......................... not ok 1 - new # TODO not implemeted ok t/pmc/env..............................ok t/pmc/eval.............................ok t/pmc/eventhandler.....................ok t/pmc/exception........................ not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans not ok 25 - pushaction: error while handling error # TODO runloop shenanigans not ok 27 - invoke handler in calling sub # TODO deprecate rethrow not ok 30 - catch ex from C-level MULTI function # TODO broken ok t/pmc/exceptionhandler.................ok t/pmc/exporter.........................ok t/pmc/file.............................ok t/pmc/filehandle....................... ok 3 # SKIP no asynch calls yet not ok 8 - record_separator # TODO not yet implemented ok t/pmc/fixedbooleanarray................ok t/pmc/fixedfloatarray..................ok t/pmc/fixedintegerarray................ok t/pmc/fixedpmcarray....................ok t/pmc/fixedstringarray.................ok t/pmc/float............................ok t/pmc/freeze...........................ok t/pmc/globals..........................ok t/pmc/hash.............................ok t/pmc/integer..........................ok t/pmc/io............................... not ok 1 - IO on some invalid types # TODO IO on some invalid types ok 8 # SKIP clone not finished yet not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433 not ok 40 - string read/write handle # TODO no stringhandle yet ok t/pmc/io_iterator...................... not ok 1 - new # TODO not yet implemented not ok 2 - shift # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented ok t/pmc/io_status........................ not ok 1 - new # TODO not yet implemented not ok 2 - get_integer (vtable) # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented not ok 4 - return # TODO not yet implemented not ok 5 - error # TODO not yet implemented not ok 6 - throw # TODO not yet implemented ok t/pmc/iterator......................... ok 13 # SKIP N/Y: length of rest of array not ok 16 - adding keys during iteration # TODO adding keys during iteration not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points' ok t/pmc/key.............................. not ok 10 # TODO register and non-register string keys should be COW (RT #60128) ok t/pmc/lexinfo..........................ok t/pmc/lexpad...........................ok t/pmc/managedstruct....................ok t/pmc/multidispatch.................... not ok 22 - MMD on PMC types - Any # TODO RT #41374 not ok 25 - add as method - inherited # TODO RT #41374 not ok 32 - use a core func for an object # TODO RT #59628 ok t/pmc/multisub.........................ok t/pmc/namespace........................ not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17 ok t/pmc/nci..............................ok t/pmc/null.............................ok t/pmc/object-meths..................... ok 14 # SKIP currently broken ok 25 # SKIP no bound NCI method ok t/pmc/object-mro.......................ok t/pmc/object...........................ok t/pmc/objects..........................ok t/pmc/orderedhash......................ok t/pmc/os...............................ok t/pmc/packfile.........................ok t/pmc/packfileconstanttable............ not ok 3 - get_type, get_*_keyed_int # TODO See TT #385. ok t/pmc/packfiledirectory................ok t/pmc/packfilefixupentry...............ok t/pmc/packfilefixuptable...............ok t/pmc/packfilerawsegment...............ok t/pmc/packfilesegment..................ok t/pmc/parrotclass......................ok t/pmc/parrotinterpreter................ok t/pmc/parrotio......................... not ok 2 - open and close - synchronous # TODO not yet implemented ok 3 # SKIP no asynch calls yet not ok 4 - print, read, and readline - synchronous # TODO not yet implemented not ok 5 - record_separator # TODO not yet implemented not ok 6 - buffer_type # TODO not yet implemented ok t/pmc/parrotlibrary....................ok t/pmc/parrotobject.....................ok t/pmc/parrotrunningthread..............ok t/pmc/parrotthread.....................ok t/pmc/pccmethod_test...................ok t/pmc/pmc..............................ok t/pmc/pmcproxy.........................ok t/pmc/pointer..........................ok t/pmc/prop.............................ok t/pmc/random...........................ok t/pmc/ref..............................ok t/pmc/resizablebooleanarray............ok t/pmc/resizablefloatarray..............ok t/pmc/resizableintegerarray............ok t/pmc/resizablepmcarray................ok t/pmc/resizablestringarray.............ok t/pmc/retcontinuation..................ok t/pmc/ro............................... not ok 8 - ResizablePMCArray -- Recursive # TODO 1 ok t/pmc/role.............................ok t/pmc/scalar........................... ok 1 # SKIP doesn't work yet ok t/pmc/scheduler........................ok t/pmc/schedulermessage.................ok t/pmc/sharedref........................ok t/pmc/signal........................... 1..0 # Skip Signals currently disabled skipped: Signals currently disabled t/pmc/slice............................ not ok 2 - bug with slice bits # TODO parser ok t/pmc/string...........................ok t/pmc/stringhandle..................... ok 3 # SKIP no asynch calls yet not ok 9 - record_separator # TODO not yet implemented ok t/pmc/sub..............................ok t/pmc/sys..............................ok t/pmc/task.............................ok t/pmc/threads.......................... not ok 11 - CLONE_CODE | CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511 not ok 15 - CLONE_CODE|CLONE_GLOBALS|CLONE_HLL|CLONE_LIBRARIES # TODO RT #41373 ok t/pmc/timer............................ok t/pmc/undef............................ok t/pmc/unmanagedstruct..................ok t/oo/attributes........................ok t/oo/composition.......................ok t/oo/inheritance.......................ok t/oo/isa...............................ok t/oo/metamodel......................... not ok 6 # TODO tail attribute has a type not ok 12 # TODO new opcode makes working objects ok t/oo/methods...........................ok t/oo/mro-c3............................ok t/oo/names.............................ok t/oo/new...............................ok t/oo/ops...............................ok t/oo/proxy.............................ok t/oo/subclass..........................ok t/oo/vtableoverride....................ok t/native_pbc/header.................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/native_pbc/integer................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/native_pbc/number.................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/native_pbc/string.................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/dynpmc/dynlexpad..................... not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads ok t/dynpmc/foo........................... ok 6 # SKIP No BigInt Lib configured ok t/dynpmc/gdbmhash...................... 1..0 # Skip No gdbm library available skipped: No gdbm library available t/dynpmc/md2...........................ok t/dynpmc/md4...........................ok t/dynpmc/md5...........................ok t/dynpmc/pair..........................ok t/dynpmc/rational......................ok t/dynpmc/ripemd160.....................ok t/dynpmc/rotest........................ok t/dynpmc/sha...........................ok t/dynpmc/sha1..........................ok t/dynpmc/sha256........................ 1..0 # Skip Too old library skipped: Too old library t/dynpmc/sha512........................ 1..0 # Skip Too old library skipped: Too old library t/dynpmc/subclass_with_pir_method...... not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces ok t/dynpmc/subproxy......................ok t/dynoplibs/dan........................ok t/dynoplibs/myops...................... ok 6 # SKIP dynops weird in CGP with events ok 7 # SKIP dynops weird in CGP with events ok t/compilers/pct/complete_workflow......ok t/compilers/pct/past...................ok t/compilers/pct/pct_hllcompiler........ok t/compilers/pct/post...................ok t/compilers/pge/00-basic...............ok t/compilers/pge/02-match...............ok t/compilers/pge/03-optable.............ok t/compilers/pge/04-compile.............ok t/compilers/pge/06-grammar.............ok t/compilers/pge/pge-hs.................ok t/compilers/pge/pge....................ok t/compilers/pge/pge_examples...........ok t/compilers/pge/pge_globs..............ok t/compilers/pge/pge_text...............ok t/compilers/pge/pge_util...............ok t/compilers/pge/p5regex/p5rx........... not ok 116 # TODO [re_tests:116] character class in enumeration not ok 119 # TODO [re_tests:119] character class in enumeration not ok 120 # TODO [re_tests:120] character class in enumeration not ok 123 # TODO [re_tests:123] character class in enumeration not ok 124 # TODO [re_tests:124] character class in enumeration not ok 127 # TODO [re_tests:127] character class in enumeration ok 138 # SKIP [re_tests:138] parser bug ok 139 # SKIP [re_tests:139] broken col 4? ok 143 # SKIP [re_tests:143] bug or error ok 144 # SKIP [re_tests:144] bug or error ok 148 # SKIP [re_tests:148] bug or error ok 149 # SKIP [re_tests:149] bug or error ok 155 # SKIP [re_tests:155] bug or error ok 167 # SKIP [re_tests:167] bug or error not ok 234 # TODO [re_tests:234] unknown reason not ok 235 # TODO [re_tests:235] unknown reason not ok 236 # TODO [re_tests:236] unknown reason not ok 246 # TODO [re_tests:246] unknown reason not ok 247 # TODO [re_tests:247] unknown reason ok 248 # SKIP [re_tests:248] bug or error ok 249 # SKIP [re_tests:249] bug or error ok 252 # SKIP [re_tests:252] bug or error not ok 254 # TODO [re_tests:254] unknown reason not ok 256 # TODO [re_tests:256] unknown reason not ok 257 # TODO [re_tests:257] unknown reason ok 264 # SKIP [re_tests:264] trailing modifiers ok 265 # SKIP [re_tests:265] trailing modifiers ok 266 # SKIP [re_tests:266] trailing modifiers ok 267 # SKIP [re_tests:267] trailing modifiers ok 268 # SKIP [re_tests:268] trailing modifiers ok 269 # SKIP [re_tests:269] trailing modifiers ok 270 # SKIP [re_tests:270] trailing modifiers ok 271 # SKIP [re_tests:271] trailing modifiers ok 272 # SKIP [re_tests:272] trailing modifiers ok 273 # SKIP [re_tests:273] trailing modifiers ok 274 # SKIP [re_tests:274] trailing modifiers ok 275 # SKIP [re_tests:275] trailing modifiers ok 276 # SKIP [re_tests:276] trailing modifiers ok 277 # SKIP [re_tests:277] trailing modifiers ok 278 # SKIP [re_tests:278] trailing modifiers ok 279 # SKIP [re_tests:279] trailing modifiers ok 280 # SKIP [re_tests:280] trailing modifiers ok 281 # SKIP [re_tests:281] trailing modifiers ok 282 # SKIP [re_tests:282] trailing modifiers ok 283 # SKIP [re_tests:283] trailing modifiers ok 284 # SKIP [re_tests:284] trailing modifiers ok 285 # SKIP [re_tests:285] trailing modifiers ok 286 # SKIP [re_tests:286] trailing modifiers ok 287 # SKIP [re_tests:287] trailing modifiers ok 288 # SKIP [re_tests:288] trailing modifiers ok 289 # SKIP [re_tests:289] trailing modifiers ok 290 # SKIP [re_tests:290] trailing modifiers ok 291 # SKIP [re_tests:291] trailing modifiers ok 292 # SKIP [re_tests:292] trailing modifiers ok 293 # SKIP [re_tests:293] trailing modifiers ok 294 # SKIP [re_tests:294] trailing modifiers ok 295 # SKIP [re_tests:295] trailing modifiers ok 296 # SKIP [re_tests:296] trailing modifiers ok 297 # SKIP [re_tests:297] trailing modifiers ok 298 # SKIP [re_tests:298] trailing modifiers ok 299 # SKIP [re_tests:299] trailing modifiers ok 300 # SKIP [re_tests:300] trailing modifiers ok 301 # SKIP [re_tests:301] trailing modifiers ok 302 # SKIP [re_tests:302] trailing modifiers ok 303 # SKIP [re_tests:303] trailing modifiers ok 304 # SKIP [re_tests:304] trailing modifiers ok 305 # SKIP [re_tests:305] trailing modifiers ok 306 # SKIP [re_tests:306] trailing modifiers ok 307 # SKIP [re_tests:307] trailing modifiers ok 308 # SKIP [re_tests:308] bug or error ok 309 # SKIP [re_tests:309] bug or error ok 310 # SKIP [re_tests:310] bug or error ok 311 # SKIP [re_tests:311] trailing modifiers ok 312 # SKIP [re_tests:312] trailing modifiers ok 313 # SKIP [re_tests:313] trailing modifiers ok 314 # SKIP [re_tests:314] trailing modifiers ok 315 # SKIP [re_tests:315] trailing modifiers ok 316 # SKIP [re_tests:316] trailing modifiers ok 317 # SKIP [re_tests:317] trailing modifiers ok 318 # SKIP [re_tests:318] trailing modifiers ok 319 # SKIP [re_tests:319] trailing modifiers ok 320 # SKIP [re_tests:320] trailing modifiers ok 321 # SKIP [re_tests:321] trailing modifiers ok 322 # SKIP [re_tests:322] bug or error ok 323 # SKIP [re_tests:323] bug or error ok 324 # SKIP [re_tests:324] trailing modifiers ok 325 # SKIP [re_tests:325] bug or error ok 326 # SKIP [re_tests:326] trailing modifiers ok 327 # SKIP [re_tests:327] trailing modifiers ok 328 # SKIP [re_tests:328] trailing modifiers ok 329 # SKIP [re_tests:329] trailing modifiers ok 330 # SKIP [re_tests:330] bug or error ok 331 # SKIP [re_tests:331] bug or error ok 332 # SKIP [re_tests:332] trailing modifiers ok 333 # SKIP [re_tests:333] trailing modifiers ok 334 # SKIP [re_tests:334] trailing modifiers ok 335 # SKIP [re_tests:335] trailing modifiers ok 336 # SKIP [re_tests:336] bug or error ok 337 # SKIP [re_tests:337] trailing modifiers ok 338 # SKIP [re_tests:338] trailing modifiers ok 339 # SKIP [re_tests:339] trailing modifiers ok 340 # SKIP [re_tests:340] trailing modifiers ok 341 # SKIP [re_tests:341] trailing modifiers ok 342 # SKIP [re_tests:342] trailing modifiers ok 343 # SKIP [re_tests:343] trailing modifiers ok 344 # SKIP [re_tests:344] trailing modifiers ok 345 # SKIP [re_tests:345] trailing modifiers ok 346 # SKIP [re_tests:346] trailing modifiers ok 347 # SKIP [re_tests:347] bug or error ok 348 # SKIP [re_tests:348] trailing modifiers ok 349 # SKIP [re_tests:349] trailing modifiers ok 350 # SKIP [re_tests:350] trailing modifiers ok 351 # SKIP [re_tests:351] trailing modifiers ok 352 # SKIP [re_tests:352] trailing modifiers ok 353 # SKIP [re_tests:353] trailing modifiers ok 354 # SKIP [re_tests:354] trailing modifiers ok 355 # SKIP [re_tests:355] trailing modifiers ok 356 # SKIP [re_tests:356] trailing modifiers ok 357 # SKIP [re_tests:357] trailing modifiers ok 358 # SKIP [re_tests:358] trailing modifiers ok 359 # SKIP [re_tests:359] trailing modifiers ok 360 # SKIP [re_tests:360] trailing modifiers ok 361 # SKIP [re_tests:361] trailing modifiers ok 362 # SKIP [re_tests:362] trailing modifiers ok 363 # SKIP [re_tests:363] trailing modifiers ok 364 # SKIP [re_tests:364] trailing modifiers ok 365 # SKIP [re_tests:365] trailing modifiers ok 366 # SKIP [re_tests:366] trailing modifiers ok 367 # SKIP [re_tests:367] trailing modifiers ok 368 # SKIP [re_tests:368] trailing modifiers ok 369 # SKIP [re_tests:369] trailing modifiers ok 370 # SKIP [re_tests:370] trailing modifiers ok 371 # SKIP [re_tests:371] trailing modifiers ok 372 # SKIP [re_tests:372] trailing modifiers ok 373 # SKIP [re_tests:373] trailing modifiers ok 374 # SKIP [re_tests:374] trailing modifiers ok 375 # SKIP [re_tests:375] trailing modifiers ok 376 # SKIP [re_tests:376] trailing modifiers ok 377 # SKIP [re_tests:377] trailing modifiers ok 378 # SKIP [re_tests:378] trailing modifiers ok 379 # SKIP [re_tests:379] trailing modifiers ok 380 # SKIP [re_tests:380] trailing modifiers ok 381 # SKIP [re_tests:381] trailing modifiers ok 382 # SKIP [re_tests:382] trailing modifiers ok 383 # SKIP [re_tests:383] trailing modifiers ok 384 # SKIP [re_tests:384] trailing modifiers ok 385 # SKIP [re_tests:385] trailing modifiers ok 386 # SKIP [re_tests:386] trailing modifiers ok 387 # SKIP [re_tests:387] trailing modifiers ok 388 # SKIP [re_tests:388] trailing modifiers ok 389 # SKIP [re_tests:389] trailing modifiers ok 390 # SKIP [re_tests:390] trailing modifiers ok 391 # SKIP [re_tests:391] trailing modifiers ok 392 # SKIP [re_tests:392] trailing modifiers ok 393 # SKIP [re_tests:393] trailing modifiers ok 394 # SKIP [re_tests:394] trailing modifiers ok 395 # SKIP [re_tests:395] trailing modifiers not ok 396 # TODO [re_tests:396] unknown reason not ok 397 # TODO [re_tests:397] unknown reason not ok 398 # TODO [re_tests:398] unknown reason ok 408 # SKIP [re_tests:408] bug or error not ok 419 # TODO [re_tests:419] unknown reason not ok 422 # TODO [re_tests:422] unknown reason not ok 429 # TODO [re_tests:429] unknown reason not ok 432 # TODO [re_tests:432] unknown reason not ok 434 # TODO [re_tests:434] unknown reason not ok 435 # TODO [re_tests:435] unknown reason ok 436 # SKIP [re_tests:436] bug or error not ok 439 # TODO [re_tests:439] unknown reason not ok 446 # TODO [re_tests:446] unknown reason not ok 447 # TODO [re_tests:447] unknown reason not ok 448 # TODO [re_tests:448] unknown reason not ok 449 # TODO [re_tests:449] unknown reason not ok 452 # TODO [re_tests:452] unknown reason not ok 453 # TODO [re_tests:453] unknown reason not ok 454 # TODO [re_tests:454] unknown reason not ok 455 # TODO [re_tests:455] unknown reason ok 458 # SKIP [re_tests:458] unknown reason ok 459 # SKIP [re_tests:459] unknown reason ok 460 # SKIP [re_tests:460] unknown reason ok 461 # SKIP [re_tests:461] unknown reason ok 462 # SKIP [re_tests:462] unknown reason ok 463 # SKIP [re_tests:463] unknown reason ok 464 # SKIP [re_tests:464] unknown reason ok 465 # SKIP [re_tests:465] unknown reason ok 466 # SKIP [re_tests:466] unknown reason ok 467 # SKIP [re_tests:467] unknown reason ok 468 # SKIP [re_tests:468] unknown reason ok 469 # SKIP [re_tests:469] unknown reason ok 470 # SKIP [re_tests:470] unknown reason ok 471 # SKIP [re_tests:471] unknown reason ok 472 # SKIP [re_tests:472] unknown reason ok 473 # SKIP [re_tests:473] unknown reason ok 474 # SKIP [re_tests:474] unknown reason ok 475 # SKIP [re_tests:475] unknown reason ok 476 # SKIP [re_tests:476] unknown reason ok 477 # SKIP [re_tests:477] unknown reason ok 478 # SKIP [re_tests:478] unknown reason ok 479 # SKIP [re_tests:479] unknown reason ok 480 # SKIP [re_tests:480] unknown reason ok 483 # SKIP [re_tests:483] ok 484 # SKIP [re_tests:484] ok 487 # SKIP [re_tests:487] bug or error ok 488 # SKIP [re_tests:488] bug or error ok 489 # SKIP [re_tests:489] bug or error ok 490 # SKIP [re_tests:490] bug or error ok 491 # SKIP [re_tests:491] kills a parrot ok 492 # SKIP [re_tests:492] bug or error ok 493 # SKIP [re_tests:493] kills a parrot not ok 495 # TODO [re_tests:495] unknown reason ok 496 # SKIP [re_tests:496] not ok 498 # TODO [re_tests:498] unknown reason not ok 500 # TODO [re_tests:500] unknown reason not ok 501 # TODO [re_tests:501] unknown reason ok 502 # SKIP [re_tests:502] unknown reason not ok 503 # TODO [re_tests:503] unknown reason not ok 504 # TODO [re_tests:504] unknown reason not ok 505 # TODO [re_tests:505] unknown reason not ok 506 # TODO [re_tests:506] unknown reason not ok 507 # TODO [re_tests:507] unknown reason not ok 508 # TODO [re_tests:508] unknown reason not ok 509 # TODO [re_tests:509] unknown reason not ok 510 # TODO [re_tests:510] unknown reason not ok 511 # TODO [re_tests:511] unknown reason not ok 512 # TODO [re_tests:512] unknown reason not ok 515 # TODO [re_tests:515] unknown reason not ok 521 # TODO [re_tests:521] unknown reason not ok 522 # TODO [re_tests:522] unknown reason not ok 523 # TODO [re_tests:523] unknown reason not ok 524 # TODO [re_tests:524] unknown reason not ok 527 # TODO [re_tests:527] unknown reason not ok 528 # TODO [re_tests:528] unknown reason ok 531 # SKIP [re_tests:531] bug or error ok 532 # SKIP [re_tests:532] bug or error not ok 535 # TODO [re_tests:535] unknown reason not ok 536 # TODO [re_tests:536] unknown reason not ok 539 # TODO [re_tests:539] unknown reason not ok 540 # TODO [re_tests:540] unknown reason not ok 541 # TODO [re_tests:541] unknown reason not ok 544 # TODO [re_tests:544] unknown reason not ok 545 # TODO [re_tests:545] unknown reason ok 556 # SKIP [re_tests:556] kills a parrot ok 557 # SKIP [re_tests:557] kills a parrot not ok 559 # TODO [re_tests:559] unknown reason ok 563 # SKIP [re_tests:563] bug or error ok 564 # SKIP [re_tests:564] bug or error ok 566 # SKIP [re_tests:566] bug or error ok 568 # SKIP [re_tests:568] kills a parrot ok 569 # SKIP [re_tests:569] kills a parrot ok 570 # SKIP [re_tests:570] kills a parrot ok 571 # SKIP [re_tests:571] kills a parrot ok 572 # SKIP [re_tests:572] kills a parrot ok 573 # SKIP [re_tests:573] kills a parrot ok 574 # SKIP [re_tests:574] kills a parrot ok 575 # SKIP [re_tests:575] kills a parrot ok 576 # SKIP [re_tests:576] kills a parrot ok 577 # SKIP [re_tests:577] kills a parrot ok 578 # SKIP [re_tests:578] kills a parrot ok 579 # SKIP [re_tests:579] kills a parrot ok 580 # SKIP [re_tests:580] kills a parrot ok 581 # SKIP [re_tests:581] kills a parrot ok 582 # SKIP [re_tests:582] kills a parrot ok 583 # SKIP [re_tests:583] kills a parrot ok 584 # SKIP [re_tests:584] kills a parrot ok 585 # SKIP [re_tests:585] kills a parrot ok 586 # SKIP [re_tests:586] kills a parrot ok 587 # SKIP [re_tests:587] kills a parrot ok 588 # SKIP [re_tests:588] kills a parrot ok 589 # SKIP [re_tests:589] kills a parrot ok 590 # SKIP [re_tests:590] kills a parrot ok 591 # SKIP [re_tests:591] kills a parrot ok 592 # SKIP [re_tests:592] kills a parrot ok 593 # SKIP [re_tests:593] bug or error ok 594 # SKIP [re_tests:594] bug or error not ok 595 # TODO [re_tests:595] unknown reason not ok 596 # TODO [re_tests:596] unknown reason ok 597 # SKIP [re_tests:597] unknown reason ok 598 # SKIP [re_tests:598] bug or error ok 599 # SKIP [re_tests:599] bug or error not ok 600 # TODO [re_tests:600] unknown reason not ok 601 # TODO [re_tests:601] unknown reason not ok 603 # TODO [re_tests:603] unknown reason not ok 604 # TODO [re_tests:604] unknown reason not ok 606 # TODO [re_tests:606] unknown reason not ok 607 # TODO [re_tests:607] unknown reason ok 609 # SKIP [re_tests:609] unknown reason ok 610 # SKIP [re_tests:610] unknown reason ok 611 # SKIP [re_tests:611] unknown reason ok 612 # SKIP [re_tests:612] unknown reason ok 613 # SKIP [re_tests:613] unknown reason ok 614 # SKIP [re_tests:614] unknown reason ok 615 # SKIP [re_tests:615] unknown reason ok 616 # SKIP [re_tests:616] unknown reason ok 617 # SKIP [re_tests:617] unknown reason not ok 621 # TODO [re_tests:621] unknown reason not ok 623 # TODO [re_tests:623] unknown reason not ok 624 # TODO [re_tests:624] unknown reason not ok 625 # TODO [re_tests:625] unknown reason ok 627 # SKIP [re_tests:627] unknown reason ok 628 # SKIP [re_tests:628] unknown reason ok 629 # SKIP [re_tests:629] unknown reason ok 630 # SKIP [re_tests:630] unknown reason ok 631 # SKIP [re_tests:631] unknown reason ok 632 # SKIP [re_tests:632] unknown reason ok 633 # SKIP [re_tests:633] unknown reason ok 634 # SKIP [re_tests:634] unknown reason ok 635 # SKIP [re_tests:635] unknown reason not ok 639 # TODO [re_tests:639] unknown reason not ok 641 # TODO [re_tests:641] unknown reason not ok 642 # TODO [re_tests:642] unknown reason not ok 643 # TODO [re_tests:643] unknown reason ok 645 # SKIP [re_tests:645] unknown reason ok 646 # SKIP [re_tests:646] unknown reason ok 647 # SKIP [re_tests:647] unknown reason ok 648 # SKIP [re_tests:648] unknown reason ok 649 # SKIP [re_tests:649] unknown reason ok 650 # SKIP [re_tests:650] unknown reason ok 651 # SKIP [re_tests:651] unknown reason ok 652 # SKIP [re_tests:652] unknown reason ok 653 # SKIP [re_tests:653] unknown reason ok 663 # SKIP [re_tests:663] unknown reason ok 664 # SKIP [re_tests:664] unknown reason ok 665 # SKIP [re_tests:665] unknown reason ok 666 # SKIP [re_tests:666] unknown reason ok 667 # SKIP [re_tests:667] unknown reason ok 668 # SKIP [re_tests:668] unknown reason ok 669 # SKIP [re_tests:669] unknown reason ok 670 # SKIP [re_tests:670] unknown reason ok 671 # SKIP [re_tests:671] unknown reason ok 681 # SKIP [re_tests:681] unknown reason ok 682 # SKIP [re_tests:682] unknown reason ok 683 # SKIP [re_tests:683] unknown reason ok 684 # SKIP [re_tests:684] unknown reason ok 685 # SKIP [re_tests:685] unknown reason ok 686 # SKIP [re_tests:686] unknown reason ok 687 # SKIP [re_tests:687] unknown reason ok 688 # SKIP [re_tests:688] unknown reason ok 689 # SKIP [re_tests:689] unknown reason not ok 693 # TODO [re_tests:693] unknown reason not ok 695 # TODO [re_tests:695] unknown reason not ok 696 # TODO [re_tests:696] unknown reason not ok 697 # TODO [re_tests:697] unknown reason ok 699 # SKIP [re_tests:699] unknown reason ok 700 # SKIP [re_tests:700] unknown reason ok 701 # SKIP [re_tests:701] unknown reason ok 702 # SKIP [re_tests:702] unknown reason ok 703 # SKIP [re_tests:703] unknown reason ok 704 # SKIP [re_tests:704] unknown reason ok 705 # SKIP [re_tests:705] unknown reason ok 706 # SKIP [re_tests:706] unknown reason ok 707 # SKIP [re_tests:707] unknown reason ok 717 # SKIP [re_tests:717] unknown reason ok 718 # SKIP [re_tests:718] unknown reason ok 719 # SKIP [re_tests:719] unknown reason ok 720 # SKIP [re_tests:720] unknown reason ok 721 # SKIP [re_tests:721] unknown reason ok 722 # SKIP [re_tests:722] unknown reason ok 723 # SKIP [re_tests:723] unknown reason ok 724 # SKIP [re_tests:724] unknown reason ok 725 # SKIP [re_tests:725] unknown reason ok 735 # SKIP [re_tests:735] unknown reason ok 736 # SKIP [re_tests:736] unknown reason ok 737 # SKIP [re_tests:737] unknown reason ok 738 # SKIP [re_tests:738] unknown reason ok 739 # SKIP [re_tests:739] unknown reason ok 740 # SKIP [re_tests:740] unknown reason ok 741 # SKIP [re_tests:741] unknown reason ok 742 # SKIP [re_tests:742] unknown reason ok 743 # SKIP [re_tests:743] unknown reason not ok 747 # TODO [re_tests:747] unknown reason not ok 749 # TODO [re_tests:749] unknown reason not ok 750 # TODO [re_tests:750] unknown reason not ok 751 # TODO [re_tests:751] unknown reason ok 753 # SKIP [re_tests:753] unknown reason ok 754 # SKIP [re_tests:754] unknown reason ok 755 # SKIP [re_tests:755] unknown reason ok 756 # SKIP [re_tests:756] unknown reason ok 757 # SKIP [re_tests:757] unknown reason ok 758 # SKIP [re_tests:758] unknown reason ok 759 # SKIP [re_tests:759] unknown reason ok 760 # SKIP [re_tests:760] unknown reason ok 761 # SKIP [re_tests:761] unknown reason ok 771 # SKIP [re_tests:771] unknown reason ok 772 # SKIP [re_tests:772] unknown reason ok 773 # SKIP [re_tests:773] unknown reason ok 774 # SKIP [re_tests:774] unknown reason ok 775 # SKIP [re_tests:775] unknown reason ok 776 # SKIP [re_tests:776] unknown reason ok 777 # SKIP [re_tests:777] unknown reason ok 778 # SKIP [re_tests:778] unknown reason ok 779 # SKIP [re_tests:779] unknown reason ok 789 # SKIP [re_tests:789] unknown reason ok 790 # SKIP [re_tests:790] unknown reason ok 791 # SKIP [re_tests:791] unknown reason ok 792 # SKIP [re_tests:792] unknown reason ok 793 # SKIP [re_tests:793] unknown reason ok 794 # SKIP [re_tests:794] unknown reason ok 795 # SKIP [re_tests:795] unknown reason ok 796 # SKIP [re_tests:796] unknown reason ok 797 # SKIP [re_tests:797] unknown reason ok 800 # SKIP [re_tests:800] not ok 801 # TODO [re_tests:801] unknown reason ok 802 # SKIP [re_tests:802] ok 803 # SKIP [re_tests:803] ok 805 # SKIP [re_tests:805] ok 806 # SKIP [re_tests:806] hangs a parrot ok 807 # SKIP [re_tests:807] hangs a parrot ok 808 # SKIP [re_tests:808] hangs a parrot ok 809 # SKIP [re_tests:809] hangs a parrot ok 810 # SKIP [re_tests:810] hangs a parrot ok 811 # SKIP [re_tests:811] hangs a parrot ok 812 # SKIP [re_tests:812] hangs a parrot ok 813 # SKIP [re_tests:813] hangs a parrot ok 814 # SKIP [re_tests:814] hangs a parrot ok 815 # SKIP [re_tests:815] hangs a parrot ok 816 # SKIP [re_tests:816] hangs a parrot ok 817 # SKIP [re_tests:817] hangs a parrot ok 818 # SKIP [re_tests:818] hangs a parrot ok 819 # SKIP [re_tests:819] hangs a parrot ok 820 # SKIP [re_tests:820] hangs a parrot ok 821 # SKIP [re_tests:821] hangs a parrot ok 822 # SKIP [re_tests:822] hangs a parrot ok 823 # SKIP [re_tests:823] hangs a parrot not ok 827 # TODO [re_tests:827] \d in character class ok 828 # SKIP [re_tests:828] ok 829 # SKIP [re_tests:829] ok 830 # SKIP [re_tests:830] ok 834 # SKIP [re_tests:834] ok 835 # SKIP [re_tests:835] ok 836 # SKIP [re_tests:836] ok 838 # SKIP [re_tests:838] not ok 858 # TODO [re_tests:858] unknown reason ok 859 # SKIP [re_tests:859] ok 862 # SKIP [re_tests:862] not ok 865 # TODO [re_tests:865] unknown reason not ok 866 # TODO [re_tests:866] unknown reason ok 877 # SKIP [re_tests:877] ok 879 # SKIP [re_tests:879] [ID 20010811.006] not ok 881 # TODO [re_tests:881] unknown reason ok 886 # SKIP [re_tests:886] not ok 887 # TODO [re_tests:887] unknown reason not ok 888 # TODO [re_tests:888] unknown reason not ok 890 # TODO [re_tests:890] unknown reason not ok 891 # TODO [re_tests:891] unknown reason not ok 893 # TODO [re_tests:893] unknown reason not ok 896 # TODO [re_tests:896] unknown reason not ok 897 # TODO [re_tests:897] unknown reason not ok 898 # TODO [re_tests:898] unknown reason not ok 899 # TODO [re_tests:899] unknown reason not ok 901 # TODO [re_tests:901] greediness/lookbehind not ok 904 # TODO [re_tests:904] greediness/lookbehind not ok 905 # TODO [re_tests:905] greediness/lookbehind not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion not ok 915 # TODO [re_tests:915] non-greedy/lookbehind not ok 916 # TODO [re_tests:916] non-greedy/lookbehind not ok 918 # TODO [re_tests:918] non-greedy/lookbehind not ok 921 # TODO [re_tests:921] non-greedy/lookbehind not ok 922 # TODO [re_tests:922] non-greedy/lookbehind not ok 923 # TODO [re_tests:923] unmatched bracket ok 924 # SKIP [re_tests:924] ok 926 # SKIP [re_tests:926] [perl #18019] not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171] not ok 928 # TODO [re_tests:928] reuse captured group not ok 929 # TODO [re_tests:929] reuse captured group not ok 930 # TODO [re_tests:930] reuse captured group not ok 931 # TODO [re_tests:931] reuse captured group not ok 932 # TODO [re_tests:932] reuse captured group not ok 933 # TODO [re_tests:933] reuse captured group not ok 934 # TODO [re_tests:934] reuse captured group not ok 935 # TODO [re_tests:935] reuse captured group not ok 936 # TODO [re_tests:936] reuse captured group not ok 937 # TODO [re_tests:937] reuse captured group not ok 938 # TODO [re_tests:938] reuse captured group not ok 939 # TODO [re_tests:939] reuse captured group not ok 940 # TODO [re_tests:940] reuse captured group not ok 941 # TODO [re_tests:941] reuse captured group not ok 942 # TODO [re_tests:942] reuse captured group ok 944 # SKIP [re_tests:944] unknown reason ok 945 # SKIP [re_tests:945] unknown reason ok 957 # SKIP [re_tests:957] ok 958 # SKIP [re_tests:958] not ok 959 # TODO [re_tests:959] [perl #34195] not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion ok t/compilers/pge/perl6regex/01-regex.... not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&|) - parse error not ok 99 # TODO [rx_metachars:114] null pattern invalid not ok 386 # TODO [rx_backtrack:4] basic not ok 427 # TODO [rx_charclass:26] illegal character range not ok 458 # TODO [rx_charclass:62] literal match (\") not ok 459 # TODO [rx_charclass:64] literal match (\") not ok 460 # TODO [rx_charclass:66] literal match with quote not ok 461 # TODO [rx_charclass:68] literal match with quote not ok 462 # TODO [rx_charclass:70] literal match with backslash not ok 463 # TODO [rx_charclass:72] literal match with interpolation not ok 464 # TODO [rx_charclass:74] literal match with interpolation not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i) not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s) not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s) not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s) not ok 709 # TODO [rx_modifiers:131] basic ws match not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5) not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth) not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth) ok t/compilers/pge/perl6regex/context..... not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented ok t/compilers/tge/basic..................ok t/compilers/tge/grammar................ not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug ok t/compilers/tge/parser.................ok t/library/cgi_query_hash...............ok t/library/coroutine....................ok t/library/dumper.......................ok t/library/getopt_obj...................ok t/library/hllmacros....................ok t/library/iter.........................ok t/library/md5..........................ok t/library/mime_base64..................ok t/library/mt19937ar....................ok t/library/p6object..................... not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) > ok t/library/parrotlib....................ok t/library/pcre......................... ok 1 # SKIP no pcre-config ok t/library/pg........................... ok 1 # SKIP skipped ok 2 # SKIP skipped ok 3 # SKIP skipped ok 4 # SKIP skipped ok 5 # SKIP skipped ok 6 # SKIP skipped ok 7 # SKIP skipped ok 8 # SKIP skipped ok 9 # SKIP skipped ok 10 # SKIP skipped ok 11 # SKIP skipped ok 12 # SKIP skipped ok 13 # SKIP skipped ok 14 # SKIP skipped ok 15 # SKIP skipped ok 16 # SKIP skipped ok 17 # SKIP skipped ok 18 # SKIP skipped ok 19 # SKIP skipped ok 20 # SKIP skipped ok 21 # SKIP skipped ok 22 # SKIP skipped ok 23 # SKIP skipped ok 24 # SKIP skipped ok 25 # SKIP skipped ok 26 # SKIP skipped ok 27 # SKIP skipped ok 28 # SKIP skipped ok 29 # SKIP skipped ok 30 # SKIP skipped ok 31 # SKIP skipped ok 32 # SKIP skipped ok 33 # SKIP skipped ok 34 # SKIP skipped ok 35 # SKIP skipped ok 36 # SKIP skipped ok 37 # SKIP skipped ok 38 # SKIP skipped ok 39 # SKIP skipped ok 40 # SKIP skipped ok 41 # SKIP skipped ok 42 # SKIP skipped ok 43 # SKIP skipped ok t/library/protoobject..................ok t/library/rand.........................ok t/library/range........................ok t/library/streams...................... ok 18 # SKIP broken method invocation ok 20 # SKIP broken method invocation ok t/library/string_utils.................ok t/library/tcl_glob.....................ok t/library/tcl_lib......................ok t/library/test_builder_tester..........ok t/library/test_class...................ok t/library/test_more....................ok t/library/uuid.........................ok t/library/yaml_dumper.................. not ok 7 - properties # TODO not yet implemented not ok 8 - indent string # TODO not supported not ok 9 - back-referencing properties # TODO not yet implemented not ok 10 - self-referential properties (1) # TODO not yet implemented not ok 11 - self-referential properties (2) # TODO not yet implemented not ok 26 - custom dumper # TODO not yet implemented ok t/library/yaml_parser_syck............. not ok 1 - basic parsing # TODO Not properly implemented yet ok All tests successful. Files=252, Tests=8326, 407 wallclock secs ( 5.99 usr 4.01 sys + 185.26 cusr 109.53 csys = 304.79 CPU) Result: PASS perl t/harness --gc-debug --running-make-test -j --runcore-tests t/compilers/imcc/imcpasm/cfg...........ok t/compilers/imcc/imcpasm/opt0.......... ok 1 # SKIP disabled graph coloring register allocator, RT #57028 ok 3 # SKIP disabled graph coloring register allocator, RT #57028 ok t/compilers/imcc/imcpasm/opt1.......... ok 76 # SKIP constant concat N/Y ok t/compilers/imcc/imcpasm/opt2.......... ok 5 # SKIP loop opt disabled for now ok t/compilers/imcc/imcpasm/optc.......... not ok 9 - tailcall 1 # TODO RT #57028 ok t/compilers/imcc/imcpasm/pcc...........ok t/compilers/imcc/imcpasm/sub...........ok t/compilers/imcc/reg/alloc.............ok t/compilers/imcc/reg/spill.............ok t/compilers/imcc/syn/bsr...............ok t/compilers/imcc/syn/clash............. not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet ok t/compilers/imcc/syn/const.............ok t/compilers/imcc/syn/errors............ok t/compilers/imcc/syn/eval.............. ok 1 # SKIP changed eval semantics - see t/pmc/eval.t ok 2 # SKIP changed eval semantics - see t/pmc/eval.t ok 3 # SKIP changed eval semantics - see t/pmc/eval.t ok 4 # SKIP changed eval semantics - see t/pmc/eval.t ok 5 # SKIP changed eval semantics - see t/pmc/eval.t ok 6 # SKIP changed eval semantics - see t/pmc/eval.t ok 7 # SKIP changed eval semantics - see t/pmc/eval.t ok t/compilers/imcc/syn/file.............. ok 13 # SKIP multiple loading not speced - failing ok t/compilers/imcc/syn/hll...............ok t/compilers/imcc/syn/keyed............. ok 1 # SKIP experimental ok t/compilers/imcc/syn/labels............ok t/compilers/imcc/syn/macro............. not ok 25 - unterminated macro 2 # TODO Darwin segfault -- RT #60926 ok t/compilers/imcc/syn/objects...........ok t/compilers/imcc/syn/op................ok t/compilers/imcc/syn/pasm..............ok t/compilers/imcc/syn/pcc...............ok t/compilers/imcc/syn/pod............... ok 4 # SKIP Closing out of pod from included files ok t/compilers/imcc/syn/regressions....... not ok 4 - comments between .param(RT \#46499) # TODO broken not ok 6 - whitespace between .param(RT \#46499) # TODO broken not ok 7 - off by one error message (RT \#40204) # TODO broken ok t/compilers/imcc/syn/scope.............ok t/compilers/imcc/syn/subflags.......... not ok 15 # TODO :method sub not found in namespace ok t/compilers/imcc/syn/symbols...........ok t/compilers/imcc/syn/tail..............ok t/compilers/imcc/syn/veracity..........ok t/op/00ff-dos..........................ok t/op/00ff-unix.........................ok t/op/01-parse_ops...................... 1..0 # Skip IMCC cannot do parse-only with JIT enabled skipped: IMCC cannot do parse-only with JIT enabled t/op/64bit............................. 1..0 # Skip 64bit INTVAL platforms only skipped: 64bit INTVAL platforms only t/op/annotate..........................ok t/op/arithmetics....................... ok 28 # SKIP No integer overflow for 32-bit INTVALs without GMP installed ok t/op/basic.............................ok t/op/bitwise........................... ok 27 # SKIP no BigInt lib found ok t/op/box...............................ok t/op/calling........................... not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all not ok 93 - arg mismatch with no params # TODO RT #39844 ok t/op/cc_params.........................ok t/op/cc_state.......................... not ok 6 - positional found, named expected # TODO cc processor state missing not ok 8 - G2: argument underflow: required slurpy param # TODO failing ok t/op/cmp-nonbranch.....................ok t/op/comp..............................ok t/op/copy..............................ok t/op/debuginfo......................... ok 7 # SKIP disabled on this core ok 8 # SKIP disabled on this core ok t/op/exceptions........................ not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans ok t/op/gc................................ok t/op/globals...........................ok t/op/hacks............................. ok 1 # SKIP no universal SIGFPE handling ok 2 # SKIP no universal SIGFPE handling ok t/op/ifunless..........................ok t/op/integer...........................ok t/op/interp............................ ok 1 # SKIP we really shouldn't run just a label - use a sub ok t/op/io................................ok t/op/jit...............................ok t/op/jitn..............................ok t/op/lexicals.......................... not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented ok t/op/literal...........................ok t/op/load_bytecode.....................ok t/op/number............................ok t/op/pushaction........................ not ok 7 - pushaction: error while handling error # TODO runloop shenanigans ok t/op/say...............................ok t/op/spawnw............................ok t/op/sprintf........................... ok 5 # SKIP parrot extension (%B) ok 7 # SKIP perl5-specific extension (%D) ok 9 # SKIP perl5-specific extension (%F) ok 16 # SKIP parrot extension (%H) ok 20 # SKIP parrot extension (%L) ok 23 # SKIP perl5-specific extension (%O) ok 24 # SKIP parrot extension (%P) ok 27 # SKIP parrot extension (%S) ok 29 # SKIP perl5-specific extension (%U) not ok 64 # TODO [%03.2d] actual: > 01< ok 71 # SKIP perl5-specific extension (%v...) ok 72 # SKIP perl5-specific extension (%v...) ok 73 # SKIP perl5-specific extension (%v...) ok 74 # SKIP perl5-specific extension (%v...) ok 75 # SKIP perl5-specific extension (%v...) ok 76 # SKIP perl5-specific extension (%v...) ok 77 # SKIP perl5-specific extension (%v...) ok 78 # SKIP perl5-specific extension (%v...) ok 79 # SKIP perl5-specific extension (%v...) ok 80 # SKIP perl5-specific extension (%v...) ok 81 # SKIP perl5-specific extension (%v...) ok 82 # SKIP perl5-specific extension (%v...) ok 83 # SKIP perl5-specific extension (%v...) ok 84 # SKIP perl5-specific extension (%v...) ok 85 # SKIP perl5-specific extension (%v...) ok 86 # SKIP perl5-specific extension (%v...) ok 87 # SKIP perl5-specific extension (%v...) ok 88 # SKIP perl5-specific extension (%v...) ok 89 # SKIP perl5-specific extension (%v...) ok 90 # SKIP perl5-specific extension (%v...) ok 91 # SKIP perl5-specific extension (%v...) ok 92 # SKIP perl5-specific extension (%v...) ok 93 # SKIP perl5-specific extension (%v...) ok 94 # SKIP perl5-specific extension (%v...) ok 95 # SKIP perl5-specific extension (%v...) ok 96 # SKIP perl5-specific extension (%v...) ok 97 # SKIP perl5-specific extension (%v...) ok 98 # SKIP perl5-specific extension (%v...) ok 99 # SKIP perl5-specific extension (%v...) ok 114 # SKIP harness needs support for * modifier ok 131 # SKIP harness needs support for * modifier ok 141 # SKIP harness needs support for * modifier ok 144 # SKIP perl5 expresssion as test value not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1< ok 161 # SKIP harness needs support for * modifier ok 166 # SKIP harness needs support for * modifier not ok 187 # TODO [%h] actual: >< not ok 191 # TODO [%l] actual: >< ok 193 # SKIP perl5-specific test ok 200 # SKIP perl5-specific test ok 201 # SKIP perl5-specific test ok 202 # SKIP parrot extension (%p) ok 204 # SKIP parrot extension (%r) ok 210 # SKIP harness needs support for * modifier ok 214 # SKIP harness needs support for * modifier not ok 223 # TODO [%v] actual: >< ok 233 # SKIP harness needs support for * modifier ok 234 # SKIP perl5-specific extension (%v...) ok 235 # SKIP perl5-specific extension (%v...) ok 238 # SKIP perl5-specific test ok 239 # SKIP perl5-specific test ok 240 # SKIP perl5-specific test ok 241 # SKIP perl5-specific test ok 242 # SKIP perl5-specific test ok 243 # SKIP perl5-specific test ok 244 # SKIP perl5-specific test ok 245 # SKIP perl5-specific test ok 246 # SKIP perl5-specific test ok 247 # SKIP perl5-specific test ok 248 # SKIP perl5-specific test ok 249 # SKIP perl5-specific test ok 250 # SKIP perl5-specific test ok 251 # SKIP perl5-specific test ok 252 # SKIP perl5-specific extension (%v...) ok 253 # SKIP perl5-specific extension (%v...) ok 254 # SKIP perl5-specific extension (%v...) ok 255 # SKIP perl5-specific extension (%v...) ok 256 # SKIP perl5-specific extension (%v...) ok 257 # SKIP perl5-specific extension (%v...) ok 258 # SKIP perl5-specific extension (%v...) ok 259 # SKIP perl5-specific extension (%v...) ok 260 # SKIP perl5-specific extension (%v...) ok 261 # SKIP perl5-specific extension (%v...) ok 262 # SKIP perl5-specific extension (%v...) ok 263 # SKIP perl5-specific extension (%v...) ok 264 # SKIP perl5-specific extension (%v...) ok 265 # SKIP perl5-specific extension (%v...) ok 266 # SKIP perl5-specific extension (%v...) ok 267 # SKIP perl5-specific extension (%v...) ok 268 # SKIP perl5-specific extension (%v...) ok 269 # SKIP perl5-specific extension (%v...) ok 270 # SKIP perl5-specific extension (%v...) ok 271 # SKIP perl5-specific extension (%v...) ok 272 # SKIP perl5-specific extension (%v...) ok 273 # SKIP perl5-specific extension (%v...) ok 274 # SKIP perl5-specific extension (%v...) ok 275 # SKIP perl5-specific extension (%v...) ok 276 # SKIP perl5-specific extension (%v...) ok 277 # SKIP perl5-specific extension (%v...) ok 278 # SKIP perl5-specific extension (%v...) ok 279 # SKIP perl5-specific extension (%v...) ok 280 # SKIP perl5-specific extension (%v...) ok 281 # SKIP perl5-specific extension (%v...) ok 282 # SKIP perl5-specific extension (%v...) ok 283 # SKIP perl5-specific extension (%v...) ok 284 # SKIP perl5-specific extension (%v...) ok 285 # SKIP perl5-specific extension (%v...) ok 286 # SKIP perl5-specific extension (%v...) ok 287 # SKIP perl5-specific extension (%v...) ok 288 # SKIP perl5-specific extension (%v...) ok 289 # SKIP perl5-specific extension (%v...) ok 290 # SKIP perl5-specific extension (%v...) ok 291 # SKIP perl5-specific extension (%v...) ok 292 # SKIP perl5-specific extension (%v...) ok 293 # SKIP perl5-specific extension (%v...) ok 294 # SKIP perl5-specific extension (%v...) ok 295 # SKIP perl5-specific extension (%v...) ok 296 # SKIP perl5-specific extension (%v...) ok 297 # SKIP perl5-specific extension (%v...) ok 298 # SKIP perl5-specific extension (%v...) ok 300 # SKIP harness needs support for * modifier not ok 304 # TODO [%#b] actual: >0b0< not ok 305 # TODO [%#o] actual: >00< not ok 306 # TODO [%#x] actual: >0x0< ok 307 # SKIP perl5-specific extension (%v...) ok 308 # SKIP perl5-specific extension (%v...) ok t/op/sprintf2..........................ok t/op/string............................ ok 103 # SKIP Pending rework of creating non-ascii literals ok 104 # SKIP Pending rework of creating non-ascii literals ok 118 # SKIP Pending reimplementation of find_encoding ok 119 # SKIP no more visible encoding ok 137 # SKIP No unicode yet ok 139 # SKIP no more transcode ok 140 # SKIP no more chartype ok t/op/string_cclass..................... ok 7 # SKIP unicode support unavailable ok 8 # SKIP unicode support unavailable ok 9 # SKIP unicode support unavailable ok t/op/string_cs......................... ok 31 # SKIP no ICU lib ok 32 # SKIP no ICU lib ok 33 # SKIP no ICU lib ok 34 # SKIP no ICU lib ok 35 # SKIP no ICU lib ok 36 # SKIP no ICU lib ok 37 # SKIP no ICU lib ok 38 # SKIP no ICU lib ok 39 # SKIP no ICU lib ok 40 # SKIP no ICU lib ok 41 # SKIP no ICU lib ok 42 # SKIP no ICU lib ok 43 # SKIP no ICU lib ok 44 # SKIP no ICU lib ok 45 # SKIP no ICU lib ok 46 # SKIP no ICU lib ok t/op/string_mem........................ok t/op/stringu........................... ok 20 # SKIP no ICU lib ok 21 # SKIP no ICU lib ok 22 # SKIP no ICU lib ok 25 # SKIP Tests seem to fail on big endian machines with icu ok 26 # SKIP Tests seem to fail on big endian machines with icu not ok 27 - UTF-8 and Unicode literals # TODO TT #24 ok t/op/sysinfo........................... not ok 11 - sysinfo OS version string # TODO Not Currently Implemented not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented ok 13 # SKIP Requires a lot of work to find out the correct answer ok 14 # SKIP Testing only in some known platforms ok t/op/time..............................ok t/op/trans............................. ok 13 - atan2 # TODO broken under JIT TT #201 ok t/pmc/addrregistry.....................ok t/pmc/array............................ not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken ok t/pmc/bigint........................... 1..0 # Skip No BigInt Lib configured skipped: No BigInt Lib configured t/pmc/bignum........................... 1..0 # Skip No BigNum PMC enabled skipped: No BigNum PMC enabled t/pmc/boolean..........................ok t/pmc/bound_nci........................ok t/pmc/callsignature....................ok t/pmc/capture..........................ok t/pmc/class............................ not ok 28 # TODO add_method() invoking method added to class works ok t/pmc/codestring.......................ok t/pmc/complex.......................... ok 58 # SKIP div by zero not caught ok 59 # SKIP div by zero not caught ok 60 # SKIP div by zero not caught ok 86 # SKIP instantiate n/y ok 87 # SKIP instantiate n/y ok 88 # SKIP instantiate n/y ok 89 # SKIP instantiate n/y ok 126 # SKIP inf is not platform-independent ok 465 # SKIP add using subclass of Complex - RT #59630 ok 466 # SKIP add using subclass of Complex - RT #59630 ok 467 # SKIP add using subclass of Complex - RT #59630 ok t/pmc/config...........................ok t/pmc/continuation.....................ok t/pmc/coroutine........................ not ok 9 - Call an exited coroutine # TODO goes one iteration too far. ok t/pmc/cpointer.........................ok t/pmc/default.......................... not ok 1 - new # TODO not implemeted ok t/pmc/env..............................ok t/pmc/eval.............................ok t/pmc/eventhandler.....................ok t/pmc/exception........................ not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans not ok 25 - pushaction: error while handling error # TODO runloop shenanigans not ok 27 - invoke handler in calling sub # TODO deprecate rethrow not ok 30 - catch ex from C-level MULTI function # TODO broken ok t/pmc/exceptionhandler.................ok t/pmc/exporter.........................ok t/pmc/file.............................ok t/pmc/filehandle....................... ok 3 # SKIP no asynch calls yet not ok 8 - record_separator # TODO not yet implemented ok t/pmc/fixedbooleanarray................ok t/pmc/fixedfloatarray..................ok t/pmc/fixedintegerarray................ok t/pmc/fixedpmcarray....................ok t/pmc/fixedstringarray.................ok t/pmc/float............................ok t/pmc/freeze...........................ok t/pmc/globals..........................ok t/pmc/hash.............................ok t/pmc/integer..........................ok t/pmc/io............................... not ok 1 - IO on some invalid types # TODO IO on some invalid types ok 8 # SKIP clone not finished yet not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433 not ok 40 - string read/write handle # TODO no stringhandle yet ok t/pmc/io_iterator...................... not ok 1 - new # TODO not yet implemented not ok 2 - shift # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented ok t/pmc/io_status........................ not ok 1 - new # TODO not yet implemented not ok 2 - get_integer (vtable) # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented not ok 4 - return # TODO not yet implemented not ok 5 - error # TODO not yet implemented not ok 6 - throw # TODO not yet implemented ok t/pmc/iterator......................... ok 13 # SKIP N/Y: length of rest of array not ok 16 - adding keys during iteration # TODO adding keys during iteration not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points' ok t/pmc/key.............................. not ok 10 # TODO register and non-register string keys should be COW (RT #60128) ok t/pmc/lexinfo..........................ok t/pmc/lexpad...........................ok t/pmc/managedstruct....................ok t/pmc/multidispatch.................... not ok 22 - MMD on PMC types - Any # TODO RT #41374 not ok 25 - add as method - inherited # TODO RT #41374 not ok 32 - use a core func for an object # TODO RT #59628 ok t/pmc/multisub.........................ok t/pmc/namespace........................ not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17 ok t/pmc/nci.............................. not ok 42 - nci_cb_C1 - PASM # TODO RT #49718, add scheduler tasks to JIT not ok 43 - nci_cb_C1 - PIR # TODO RT #49718, add scheduler tasks to JIT not ok 44 - nci_cb_C2 - PASM # TODO RT #49718, add scheduler tasks to JIT not ok 45 - nci_cb_C3 - PIR # TODO RT #49718, add scheduler tasks to JIT not ok 46 - nci_cb_D1 - PASM # TODO RT #49718, add scheduler tasks to JIT not ok 47 - nci_cb_D2 - PASM # TODO RT #49718, add scheduler tasks to JIT not ok 48 - nci_cb_D2 - PIR # TODO RT #49718, add scheduler tasks to JIT not ok 49 - nci_cb_D3 - PIR # TODO RT #49718, add scheduler tasks to JIT ok t/pmc/null.............................ok t/pmc/object-meths..................... ok 14 # SKIP currently broken ok 25 # SKIP no bound NCI method ok t/pmc/object-mro.......................ok t/pmc/object...........................ok t/pmc/objects..........................ok t/pmc/orderedhash......................ok t/pmc/os...............................ok t/pmc/packfile.........................ok t/pmc/packfileconstanttable............ not ok 3 - get_type, get_*_keyed_int # TODO See TT #385. ok t/pmc/packfiledirectory................ok t/pmc/packfilefixupentry...............ok t/pmc/packfilefixuptable...............ok t/pmc/packfilerawsegment...............ok t/pmc/packfilesegment..................ok t/pmc/parrotclass......................ok t/pmc/parrotinterpreter................ok t/pmc/parrotio......................... not ok 2 - open and close - synchronous # TODO not yet implemented ok 3 # SKIP no asynch calls yet not ok 4 - print, read, and readline - synchronous # TODO not yet implemented not ok 5 - record_separator # TODO not yet implemented not ok 6 - buffer_type # TODO not yet implemented ok t/pmc/parrotlibrary....................ok t/pmc/parrotobject.....................ok t/pmc/parrotrunningthread..............ok t/pmc/parrotthread.....................ok t/pmc/pccmethod_test...................ok t/pmc/pmc..............................ok t/pmc/pmcproxy.........................ok t/pmc/pointer..........................ok t/pmc/prop.............................ok t/pmc/random...........................ok t/pmc/ref..............................ok t/pmc/resizablebooleanarray............ok t/pmc/resizablefloatarray..............ok t/pmc/resizableintegerarray............ok t/pmc/resizablepmcarray................ok t/pmc/resizablestringarray.............ok t/pmc/retcontinuation..................ok t/pmc/ro............................... not ok 8 - ResizablePMCArray -- Recursive # TODO 1 ok t/pmc/role.............................ok t/pmc/scalar........................... ok 1 # SKIP doesn't work yet ok t/pmc/scheduler........................ok t/pmc/schedulermessage.................ok t/pmc/sharedref........................ok t/pmc/signal........................... 1..0 # Skip Signals currently disabled skipped: Signals currently disabled t/pmc/slice............................ not ok 2 - bug with slice bits # TODO parser ok t/pmc/string...........................ok t/pmc/stringhandle..................... ok 3 # SKIP no asynch calls yet not ok 9 - record_separator # TODO not yet implemented ok t/pmc/sub..............................ok t/pmc/sys..............................ok t/pmc/task.............................ok t/pmc/threads.......................... not ok 11 - CLONE_CODE | CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511 not ok 14 - globals + constant table subs issue # TODO Broken with JIT not ok 15 - CLONE_CODE|CLONE_GLOBALS|CLONE_HLL|CLONE_LIBRARIES # TODO RT #41373 ok t/pmc/timer............................ not ok 5 - Timer setup - initializer/start/repeat # TODO RT #49718, add scheduler features to JIT ok t/pmc/undef............................ok t/pmc/unmanagedstruct..................ok t/oo/attributes........................ok t/oo/composition.......................ok t/oo/inheritance.......................ok t/oo/isa...............................ok t/oo/metamodel......................... not ok 6 # TODO tail attribute has a type not ok 12 # TODO new opcode makes working objects ok t/oo/methods...........................ok t/oo/mro-c3............................ok t/oo/names.............................ok t/oo/new...............................ok t/oo/ops...............................ok t/oo/proxy.............................ok t/oo/subclass..........................ok t/oo/vtableoverride....................ok t/native_pbc/header.................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/native_pbc/integer................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/native_pbc/number.................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/native_pbc/string.................... 1..0 # Skip pending robust testing strategy, TT #357 skipped: pending robust testing strategy, TT #357 t/dynpmc/dynlexpad..................... not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads ok t/dynpmc/foo........................... ok 6 # SKIP No BigInt Lib configured ok t/dynpmc/gdbmhash...................... 1..0 # Skip No gdbm library available skipped: No gdbm library available t/dynpmc/md2...........................ok t/dynpmc/md4...........................ok t/dynpmc/md5...........................ok t/dynpmc/pair..........................ok t/dynpmc/rational......................ok t/dynpmc/ripemd160.....................ok t/dynpmc/rotest........................ok t/dynpmc/sha...........................ok t/dynpmc/sha1..........................ok t/dynpmc/sha256........................ 1..0 # Skip Too old library skipped: Too old library t/dynpmc/sha512........................ 1..0 # Skip Too old library skipped: Too old library t/dynpmc/subclass_with_pir_method...... not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces ok t/dynpmc/subproxy......................ok t/dynoplibs/dan........................ok t/dynoplibs/myops...................... not ok 4 - a short cheating quine # TODO broken with JIT not ok 5 - one alarm # TODO RT #49718, add scheduler features to JIT not ok 6 - three alarm # TODO RT #49718, add scheduler features to JIT not ok 7 - repeating alarm # TODO RT #49718, add scheduler features to JIT ok t/compilers/pct/complete_workflow......ok t/compilers/pct/past...................ok t/compilers/pct/pct_hllcompiler........ok t/compilers/pct/post...................ok t/compilers/pge/00-basic...............ok t/compilers/pge/02-match...............ok t/compilers/pge/03-optable.............ok t/compilers/pge/04-compile.............ok t/compilers/pge/06-grammar.............ok t/compilers/pge/pge-hs.................ok t/compilers/pge/pge....................ok t/compilers/pge/pge_examples........... # Failed test 'parse FASTA' # at t/compilers/pge/pge_examples.t line 55. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # >gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus] # LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV # EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG # LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL # GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX # IENY # >poly_a teasing the parser with DNA # aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa # # Looks like you failed 1 test of 2. Dubious, test returned 1 (wstat 256, 0x100) Failed 1/2 subtests t/compilers/pge/pge_globs..............ok t/compilers/pge/pge_text...............ok t/compilers/pge/pge_util...............ok t/compilers/pge/p5regex/p5rx........... not ok 116 # TODO [re_tests:116] character class in enumeration not ok 119 # TODO [re_tests:119] character class in enumeration not ok 120 # TODO [re_tests:120] character class in enumeration not ok 123 # TODO [re_tests:123] character class in enumeration not ok 124 # TODO [re_tests:124] character class in enumeration not ok 127 # TODO [re_tests:127] character class in enumeration ok 138 # SKIP [re_tests:138] parser bug ok 139 # SKIP [re_tests:139] broken col 4? ok 143 # SKIP [re_tests:143] bug or error ok 144 # SKIP [re_tests:144] bug or error ok 148 # SKIP [re_tests:148] bug or error ok 149 # SKIP [re_tests:149] bug or error ok 155 # SKIP [re_tests:155] bug or error ok 167 # SKIP [re_tests:167] bug or error not ok 234 # TODO [re_tests:234] unknown reason not ok 235 # TODO [re_tests:235] unknown reason not ok 236 # TODO [re_tests:236] unknown reason not ok 246 # TODO [re_tests:246] unknown reason not ok 247 # TODO [re_tests:247] unknown reason ok 248 # SKIP [re_tests:248] bug or error ok 249 # SKIP [re_tests:249] bug or error ok 252 # SKIP [re_tests:252] bug or error not ok 254 # TODO [re_tests:254] unknown reason not ok 256 # TODO [re_tests:256] unknown reason not ok 257 # TODO [re_tests:257] unknown reason ok 264 # SKIP [re_tests:264] trailing modifiers ok 265 # SKIP [re_tests:265] trailing modifiers ok 266 # SKIP [re_tests:266] trailing modifiers ok 267 # SKIP [re_tests:267] trailing modifiers ok 268 # SKIP [re_tests:268] trailing modifiers ok 269 # SKIP [re_tests:269] trailing modifiers ok 270 # SKIP [re_tests:270] trailing modifiers ok 271 # SKIP [re_tests:271] trailing modifiers ok 272 # SKIP [re_tests:272] trailing modifiers ok 273 # SKIP [re_tests:273] trailing modifiers ok 274 # SKIP [re_tests:274] trailing modifiers ok 275 # SKIP [re_tests:275] trailing modifiers ok 276 # SKIP [re_tests:276] trailing modifiers ok 277 # SKIP [re_tests:277] trailing modifiers ok 278 # SKIP [re_tests:278] trailing modifiers ok 279 # SKIP [re_tests:279] trailing modifiers ok 280 # SKIP [re_tests:280] trailing modifiers ok 281 # SKIP [re_tests:281] trailing modifiers ok 282 # SKIP [re_tests:282] trailing modifiers ok 283 # SKIP [re_tests:283] trailing modifiers ok 284 # SKIP [re_tests:284] trailing modifiers ok 285 # SKIP [re_tests:285] trailing modifiers ok 286 # SKIP [re_tests:286] trailing modifiers ok 287 # SKIP [re_tests:287] trailing modifiers ok 288 # SKIP [re_tests:288] trailing modifiers ok 289 # SKIP [re_tests:289] trailing modifiers ok 290 # SKIP [re_tests:290] trailing modifiers ok 291 # SKIP [re_tests:291] trailing modifiers ok 292 # SKIP [re_tests:292] trailing modifiers ok 293 # SKIP [re_tests:293] trailing modifiers ok 294 # SKIP [re_tests:294] trailing modifiers ok 295 # SKIP [re_tests:295] trailing modifiers ok 296 # SKIP [re_tests:296] trailing modifiers ok 297 # SKIP [re_tests:297] trailing modifiers ok 298 # SKIP [re_tests:298] trailing modifiers ok 299 # SKIP [re_tests:299] trailing modifiers ok 300 # SKIP [re_tests:300] trailing modifiers ok 301 # SKIP [re_tests:301] trailing modifiers ok 302 # SKIP [re_tests:302] trailing modifiers ok 303 # SKIP [re_tests:303] trailing modifiers ok 304 # SKIP [re_tests:304] trailing modifiers ok 305 # SKIP [re_tests:305] trailing modifiers ok 306 # SKIP [re_tests:306] trailing modifiers ok 307 # SKIP [re_tests:307] trailing modifiers ok 308 # SKIP [re_tests:308] bug or error ok 309 # SKIP [re_tests:309] bug or error ok 310 # SKIP [re_tests:310] bug or error ok 311 # SKIP [re_tests:311] trailing modifiers ok 312 # SKIP [re_tests:312] trailing modifiers ok 313 # SKIP [re_tests:313] trailing modifiers ok 314 # SKIP [re_tests:314] trailing modifiers ok 315 # SKIP [re_tests:315] trailing modifiers ok 316 # SKIP [re_tests:316] trailing modifiers ok 317 # SKIP [re_tests:317] trailing modifiers ok 318 # SKIP [re_tests:318] trailing modifiers ok 319 # SKIP [re_tests:319] trailing modifiers ok 320 # SKIP [re_tests:320] trailing modifiers ok 321 # SKIP [re_tests:321] trailing modifiers ok 322 # SKIP [re_tests:322] bug or error ok 323 # SKIP [re_tests:323] bug or error ok 324 # SKIP [re_tests:324] trailing modifiers ok 325 # SKIP [re_tests:325] bug or error ok 326 # SKIP [re_tests:326] trailing modifiers ok 327 # SKIP [re_tests:327] trailing modifiers ok 328 # SKIP [re_tests:328] trailing modifiers ok 329 # SKIP [re_tests:329] trailing modifiers ok 330 # SKIP [re_tests:330] bug or error ok 331 # SKIP [re_tests:331] bug or error ok 332 # SKIP [re_tests:332] trailing modifiers ok 333 # SKIP [re_tests:333] trailing modifiers ok 334 # SKIP [re_tests:334] trailing modifiers ok 335 # SKIP [re_tests:335] trailing modifiers ok 336 # SKIP [re_tests:336] bug or error ok 337 # SKIP [re_tests:337] trailing modifiers ok 338 # SKIP [re_tests:338] trailing modifiers ok 339 # SKIP [re_tests:339] trailing modifiers ok 340 # SKIP [re_tests:340] trailing modifiers ok 341 # SKIP [re_tests:341] trailing modifiers ok 342 # SKIP [re_tests:342] trailing modifiers ok 343 # SKIP [re_tests:343] trailing modifiers ok 344 # SKIP [re_tests:344] trailing modifiers ok 345 # SKIP [re_tests:345] trailing modifiers ok 346 # SKIP [re_tests:346] trailing modifiers ok 347 # SKIP [re_tests:347] bug or error ok 348 # SKIP [re_tests:348] trailing modifiers ok 349 # SKIP [re_tests:349] trailing modifiers ok 350 # SKIP [re_tests:350] trailing modifiers ok 351 # SKIP [re_tests:351] trailing modifiers ok 352 # SKIP [re_tests:352] trailing modifiers ok 353 # SKIP [re_tests:353] trailing modifiers ok 354 # SKIP [re_tests:354] trailing modifiers ok 355 # SKIP [re_tests:355] trailing modifiers ok 356 # SKIP [re_tests:356] trailing modifiers ok 357 # SKIP [re_tests:357] trailing modifiers ok 358 # SKIP [re_tests:358] trailing modifiers ok 359 # SKIP [re_tests:359] trailing modifiers ok 360 # SKIP [re_tests:360] trailing modifiers ok 361 # SKIP [re_tests:361] trailing modifiers ok 362 # SKIP [re_tests:362] trailing modifiers ok 363 # SKIP [re_tests:363] trailing modifiers ok 364 # SKIP [re_tests:364] trailing modifiers ok 365 # SKIP [re_tests:365] trailing modifiers ok 366 # SKIP [re_tests:366] trailing modifiers ok 367 # SKIP [re_tests:367] trailing modifiers ok 368 # SKIP [re_tests:368] trailing modifiers ok 369 # SKIP [re_tests:369] trailing modifiers ok 370 # SKIP [re_tests:370] trailing modifiers ok 371 # SKIP [re_tests:371] trailing modifiers ok 372 # SKIP [re_tests:372] trailing modifiers ok 373 # SKIP [re_tests:373] trailing modifiers ok 374 # SKIP [re_tests:374] trailing modifiers ok 375 # SKIP [re_tests:375] trailing modifiers ok 376 # SKIP [re_tests:376] trailing modifiers ok 377 # SKIP [re_tests:377] trailing modifiers ok 378 # SKIP [re_tests:378] trailing modifiers ok 379 # SKIP [re_tests:379] trailing modifiers ok 380 # SKIP [re_tests:380] trailing modifiers ok 381 # SKIP [re_tests:381] trailing modifiers ok 382 # SKIP [re_tests:382] trailing modifiers ok 383 # SKIP [re_tests:383] trailing modifiers ok 384 # SKIP [re_tests:384] trailing modifiers ok 385 # SKIP [re_tests:385] trailing modifiers ok 386 # SKIP [re_tests:386] trailing modifiers ok 387 # SKIP [re_tests:387] trailing modifiers ok 388 # SKIP [re_tests:388] trailing modifiers ok 389 # SKIP [re_tests:389] trailing modifiers ok 390 # SKIP [re_tests:390] trailing modifiers ok 391 # SKIP [re_tests:391] trailing modifiers ok 392 # SKIP [re_tests:392] trailing modifiers ok 393 # SKIP [re_tests:393] trailing modifiers ok 394 # SKIP [re_tests:394] trailing modifiers ok 395 # SKIP [re_tests:395] trailing modifiers not ok 396 # TODO [re_tests:396] unknown reason not ok 397 # TODO [re_tests:397] unknown reason not ok 398 # TODO [re_tests:398] unknown reason ok 408 # SKIP [re_tests:408] bug or error not ok 419 # TODO [re_tests:419] unknown reason not ok 422 # TODO [re_tests:422] unknown reason not ok 429 # TODO [re_tests:429] unknown reason not ok 432 # TODO [re_tests:432] unknown reason not ok 434 # TODO [re_tests:434] unknown reason not ok 435 # TODO [re_tests:435] unknown reason ok 436 # SKIP [re_tests:436] bug or error not ok 439 # TODO [re_tests:439] unknown reason not ok 446 # TODO [re_tests:446] unknown reason not ok 447 # TODO [re_tests:447] unknown reason not ok 448 # TODO [re_tests:448] unknown reason not ok 449 # TODO [re_tests:449] unknown reason not ok 452 # TODO [re_tests:452] unknown reason not ok 453 # TODO [re_tests:453] unknown reason not ok 454 # TODO [re_tests:454] unknown reason not ok 455 # TODO [re_tests:455] unknown reason ok 458 # SKIP [re_tests:458] unknown reason ok 459 # SKIP [re_tests:459] unknown reason ok 460 # SKIP [re_tests:460] unknown reason ok 461 # SKIP [re_tests:461] unknown reason ok 462 # SKIP [re_tests:462] unknown reason ok 463 # SKIP [re_tests:463] unknown reason ok 464 # SKIP [re_tests:464] unknown reason ok 465 # SKIP [re_tests:465] unknown reason ok 466 # SKIP [re_tests:466] unknown reason ok 467 # SKIP [re_tests:467] unknown reason ok 468 # SKIP [re_tests:468] unknown reason ok 469 # SKIP [re_tests:469] unknown reason ok 470 # SKIP [re_tests:470] unknown reason ok 471 # SKIP [re_tests:471] unknown reason ok 472 # SKIP [re_tests:472] unknown reason ok 473 # SKIP [re_tests:473] unknown reason ok 474 # SKIP [re_tests:474] unknown reason ok 475 # SKIP [re_tests:475] unknown reason ok 476 # SKIP [re_tests:476] unknown reason ok 477 # SKIP [re_tests:477] unknown reason ok 478 # SKIP [re_tests:478] unknown reason ok 479 # SKIP [re_tests:479] unknown reason ok 480 # SKIP [re_tests:480] unknown reason ok 483 # SKIP [re_tests:483] ok 484 # SKIP [re_tests:484] ok 487 # SKIP [re_tests:487] bug or error ok 488 # SKIP [re_tests:488] bug or error ok 489 # SKIP [re_tests:489] bug or error ok 490 # SKIP [re_tests:490] bug or error ok 491 # SKIP [re_tests:491] kills a parrot ok 492 # SKIP [re_tests:492] bug or error ok 493 # SKIP [re_tests:493] kills a parrot not ok 495 # TODO [re_tests:495] unknown reason ok 496 # SKIP [re_tests:496] not ok 498 # TODO [re_tests:498] unknown reason not ok 500 # TODO [re_tests:500] unknown reason not ok 501 # TODO [re_tests:501] unknown reason ok 502 # SKIP [re_tests:502] unknown reason not ok 503 # TODO [re_tests:503] unknown reason not ok 504 # TODO [re_tests:504] unknown reason not ok 505 # TODO [re_tests:505] unknown reason not ok 506 # TODO [re_tests:506] unknown reason not ok 507 # TODO [re_tests:507] unknown reason not ok 508 # TODO [re_tests:508] unknown reason not ok 509 # TODO [re_tests:509] unknown reason not ok 510 # TODO [re_tests:510] unknown reason not ok 511 # TODO [re_tests:511] unknown reason not ok 512 # TODO [re_tests:512] unknown reason not ok 515 # TODO [re_tests:515] unknown reason not ok 521 # TODO [re_tests:521] unknown reason not ok 522 # TODO [re_tests:522] unknown reason not ok 523 # TODO [re_tests:523] unknown reason not ok 524 # TODO [re_tests:524] unknown reason not ok 527 # TODO [re_tests:527] unknown reason not ok 528 # TODO [re_tests:528] unknown reason ok 531 # SKIP [re_tests:531] bug or error ok 532 # SKIP [re_tests:532] bug or error not ok 535 # TODO [re_tests:535] unknown reason not ok 536 # TODO [re_tests:536] unknown reason not ok 539 # TODO [re_tests:539] unknown reason not ok 540 # TODO [re_tests:540] unknown reason not ok 541 # TODO [re_tests:541] unknown reason not ok 544 # TODO [re_tests:544] unknown reason not ok 545 # TODO [re_tests:545] unknown reason ok 556 # SKIP [re_tests:556] kills a parrot ok 557 # SKIP [re_tests:557] kills a parrot not ok 559 # TODO [re_tests:559] unknown reason ok 563 # SKIP [re_tests:563] bug or error ok 564 # SKIP [re_tests:564] bug or error ok 566 # SKIP [re_tests:566] bug or error ok 568 # SKIP [re_tests:568] kills a parrot ok 569 # SKIP [re_tests:569] kills a parrot ok 570 # SKIP [re_tests:570] kills a parrot ok 571 # SKIP [re_tests:571] kills a parrot ok 572 # SKIP [re_tests:572] kills a parrot ok 573 # SKIP [re_tests:573] kills a parrot ok 574 # SKIP [re_tests:574] kills a parrot ok 575 # SKIP [re_tests:575] kills a parrot ok 576 # SKIP [re_tests:576] kills a parrot ok 577 # SKIP [re_tests:577] kills a parrot ok 578 # SKIP [re_tests:578] kills a parrot ok 579 # SKIP [re_tests:579] kills a parrot ok 580 # SKIP [re_tests:580] kills a parrot ok 581 # SKIP [re_tests:581] kills a parrot ok 582 # SKIP [re_tests:582] kills a parrot ok 583 # SKIP [re_tests:583] kills a parrot ok 584 # SKIP [re_tests:584] kills a parrot ok 585 # SKIP [re_tests:585] kills a parrot ok 586 # SKIP [re_tests:586] kills a parrot ok 587 # SKIP [re_tests:587] kills a parrot ok 588 # SKIP [re_tests:588] kills a parrot ok 589 # SKIP [re_tests:589] kills a parrot ok 590 # SKIP [re_tests:590] kills a parrot ok 591 # SKIP [re_tests:591] kills a parrot ok 592 # SKIP [re_tests:592] kills a parrot ok 593 # SKIP [re_tests:593] bug or error ok 594 # SKIP [re_tests:594] bug or error not ok 595 # TODO [re_tests:595] unknown reason not ok 596 # TODO [re_tests:596] unknown reason ok 597 # SKIP [re_tests:597] unknown reason ok 598 # SKIP [re_tests:598] bug or error ok 599 # SKIP [re_tests:599] bug or error not ok 600 # TODO [re_tests:600] unknown reason not ok 601 # TODO [re_tests:601] unknown reason not ok 603 # TODO [re_tests:603] unknown reason not ok 604 # TODO [re_tests:604] unknown reason not ok 606 # TODO [re_tests:606] unknown reason not ok 607 # TODO [re_tests:607] unknown reason ok 609 # SKIP [re_tests:609] unknown reason ok 610 # SKIP [re_tests:610] unknown reason ok 611 # SKIP [re_tests:611] unknown reason ok 612 # SKIP [re_tests:612] unknown reason ok 613 # SKIP [re_tests:613] unknown reason ok 614 # SKIP [re_tests:614] unknown reason ok 615 # SKIP [re_tests:615] unknown reason ok 616 # SKIP [re_tests:616] unknown reason ok 617 # SKIP [re_tests:617] unknown reason not ok 621 # TODO [re_tests:621] unknown reason not ok 623 # TODO [re_tests:623] unknown reason not ok 624 # TODO [re_tests:624] unknown reason not ok 625 # TODO [re_tests:625] unknown reason ok 627 # SKIP [re_tests:627] unknown reason ok 628 # SKIP [re_tests:628] unknown reason ok 629 # SKIP [re_tests:629] unknown reason ok 630 # SKIP [re_tests:630] unknown reason ok 631 # SKIP [re_tests:631] unknown reason ok 632 # SKIP [re_tests:632] unknown reason ok 633 # SKIP [re_tests:633] unknown reason ok 634 # SKIP [re_tests:634] unknown reason ok 635 # SKIP [re_tests:635] unknown reason not ok 639 # TODO [re_tests:639] unknown reason not ok 641 # TODO [re_tests:641] unknown reason not ok 642 # TODO [re_tests:642] unknown reason not ok 643 # TODO [re_tests:643] unknown reason ok 645 # SKIP [re_tests:645] unknown reason ok 646 # SKIP [re_tests:646] unknown reason ok 647 # SKIP [re_tests:647] unknown reason ok 648 # SKIP [re_tests:648] unknown reason ok 649 # SKIP [re_tests:649] unknown reason ok 650 # SKIP [re_tests:650] unknown reason ok 651 # SKIP [re_tests:651] unknown reason ok 652 # SKIP [re_tests:652] unknown reason ok 653 # SKIP [re_tests:653] unknown reason ok 663 # SKIP [re_tests:663] unknown reason ok 664 # SKIP [re_tests:664] unknown reason ok 665 # SKIP [re_tests:665] unknown reason ok 666 # SKIP [re_tests:666] unknown reason ok 667 # SKIP [re_tests:667] unknown reason ok 668 # SKIP [re_tests:668] unknown reason ok 669 # SKIP [re_tests:669] unknown reason ok 670 # SKIP [re_tests:670] unknown reason ok 671 # SKIP [re_tests:671] unknown reason ok 681 # SKIP [re_tests:681] unknown reason ok 682 # SKIP [re_tests:682] unknown reason ok 683 # SKIP [re_tests:683] unknown reason ok 684 # SKIP [re_tests:684] unknown reason ok 685 # SKIP [re_tests:685] unknown reason ok 686 # SKIP [re_tests:686] unknown reason ok 687 # SKIP [re_tests:687] unknown reason ok 688 # SKIP [re_tests:688] unknown reason ok 689 # SKIP [re_tests:689] unknown reason not ok 693 # TODO [re_tests:693] unknown reason not ok 695 # TODO [re_tests:695] unknown reason not ok 696 # TODO [re_tests:696] unknown reason not ok 697 # TODO [re_tests:697] unknown reason ok 699 # SKIP [re_tests:699] unknown reason ok 700 # SKIP [re_tests:700] unknown reason ok 701 # SKIP [re_tests:701] unknown reason ok 702 # SKIP [re_tests:702] unknown reason ok 703 # SKIP [re_tests:703] unknown reason ok 704 # SKIP [re_tests:704] unknown reason ok 705 # SKIP [re_tests:705] unknown reason ok 706 # SKIP [re_tests:706] unknown reason ok 707 # SKIP [re_tests:707] unknown reason ok 717 # SKIP [re_tests:717] unknown reason ok 718 # SKIP [re_tests:718] unknown reason ok 719 # SKIP [re_tests:719] unknown reason ok 720 # SKIP [re_tests:720] unknown reason ok 721 # SKIP [re_tests:721] unknown reason ok 722 # SKIP [re_tests:722] unknown reason ok 723 # SKIP [re_tests:723] unknown reason ok 724 # SKIP [re_tests:724] unknown reason ok 725 # SKIP [re_tests:725] unknown reason ok 735 # SKIP [re_tests:735] unknown reason ok 736 # SKIP [re_tests:736] unknown reason ok 737 # SKIP [re_tests:737] unknown reason ok 738 # SKIP [re_tests:738] unknown reason ok 739 # SKIP [re_tests:739] unknown reason ok 740 # SKIP [re_tests:740] unknown reason ok 741 # SKIP [re_tests:741] unknown reason ok 742 # SKIP [re_tests:742] unknown reason ok 743 # SKIP [re_tests:743] unknown reason not ok 747 # TODO [re_tests:747] unknown reason not ok 749 # TODO [re_tests:749] unknown reason not ok 750 # TODO [re_tests:750] unknown reason not ok 751 # TODO [re_tests:751] unknown reason ok 753 # SKIP [re_tests:753] unknown reason ok 754 # SKIP [re_tests:754] unknown reason ok 755 # SKIP [re_tests:755] unknown reason ok 756 # SKIP [re_tests:756] unknown reason ok 757 # SKIP [re_tests:757] unknown reason ok 758 # SKIP [re_tests:758] unknown reason ok 759 # SKIP [re_tests:759] unknown reason ok 760 # SKIP [re_tests:760] unknown reason ok 761 # SKIP [re_tests:761] unknown reason ok 771 # SKIP [re_tests:771] unknown reason ok 772 # SKIP [re_tests:772] unknown reason ok 773 # SKIP [re_tests:773] unknown reason ok 774 # SKIP [re_tests:774] unknown reason ok 775 # SKIP [re_tests:775] unknown reason ok 776 # SKIP [re_tests:776] unknown reason ok 777 # SKIP [re_tests:777] unknown reason ok 778 # SKIP [re_tests:778] unknown reason ok 779 # SKIP [re_tests:779] unknown reason ok 789 # SKIP [re_tests:789] unknown reason ok 790 # SKIP [re_tests:790] unknown reason ok 791 # SKIP [re_tests:791] unknown reason ok 792 # SKIP [re_tests:792] unknown reason ok 793 # SKIP [re_tests:793] unknown reason ok 794 # SKIP [re_tests:794] unknown reason ok 795 # SKIP [re_tests:795] unknown reason ok 796 # SKIP [re_tests:796] unknown reason ok 797 # SKIP [re_tests:797] unknown reason ok 800 # SKIP [re_tests:800] not ok 801 # TODO [re_tests:801] unknown reason ok 802 # SKIP [re_tests:802] ok 803 # SKIP [re_tests:803] ok 805 # SKIP [re_tests:805] ok 806 # SKIP [re_tests:806] hangs a parrot ok 807 # SKIP [re_tests:807] hangs a parrot ok 808 # SKIP [re_tests:808] hangs a parrot ok 809 # SKIP [re_tests:809] hangs a parrot ok 810 # SKIP [re_tests:810] hangs a parrot ok 811 # SKIP [re_tests:811] hangs a parrot ok 812 # SKIP [re_tests:812] hangs a parrot ok 813 # SKIP [re_tests:813] hangs a parrot ok 814 # SKIP [re_tests:814] hangs a parrot ok 815 # SKIP [re_tests:815] hangs a parrot ok 816 # SKIP [re_tests:816] hangs a parrot ok 817 # SKIP [re_tests:817] hangs a parrot ok 818 # SKIP [re_tests:818] hangs a parrot ok 819 # SKIP [re_tests:819] hangs a parrot ok 820 # SKIP [re_tests:820] hangs a parrot ok 821 # SKIP [re_tests:821] hangs a parrot ok 822 # SKIP [re_tests:822] hangs a parrot ok 823 # SKIP [re_tests:823] hangs a parrot not ok 827 # TODO [re_tests:827] \d in character class ok 828 # SKIP [re_tests:828] ok 829 # SKIP [re_tests:829] ok 830 # SKIP [re_tests:830] ok 834 # SKIP [re_tests:834] ok 835 # SKIP [re_tests:835] ok 836 # SKIP [re_tests:836] ok 838 # SKIP [re_tests:838] not ok 858 # TODO [re_tests:858] unknown reason ok 859 # SKIP [re_tests:859] ok 862 # SKIP [re_tests:862] not ok 865 # TODO [re_tests:865] unknown reason not ok 866 # TODO [re_tests:866] unknown reason ok 877 # SKIP [re_tests:877] ok 879 # SKIP [re_tests:879] [ID 20010811.006] not ok 881 # TODO [re_tests:881] unknown reason ok 886 # SKIP [re_tests:886] not ok 887 # TODO [re_tests:887] unknown reason not ok 888 # TODO [re_tests:888] unknown reason not ok 890 # TODO [re_tests:890] unknown reason not ok 891 # TODO [re_tests:891] unknown reason not ok 893 # TODO [re_tests:893] unknown reason not ok 896 # TODO [re_tests:896] unknown reason not ok 897 # TODO [re_tests:897] unknown reason not ok 898 # TODO [re_tests:898] unknown reason not ok 899 # TODO [re_tests:899] unknown reason not ok 901 # TODO [re_tests:901] greediness/lookbehind not ok 904 # TODO [re_tests:904] greediness/lookbehind not ok 905 # TODO [re_tests:905] greediness/lookbehind not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion not ok 915 # TODO [re_tests:915] non-greedy/lookbehind not ok 916 # TODO [re_tests:916] non-greedy/lookbehind not ok 918 # TODO [re_tests:918] non-greedy/lookbehind not ok 921 # TODO [re_tests:921] non-greedy/lookbehind not ok 922 # TODO [re_tests:922] non-greedy/lookbehind not ok 923 # TODO [re_tests:923] unmatched bracket ok 924 # SKIP [re_tests:924] ok 926 # SKIP [re_tests:926] [perl #18019] not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171] not ok 928 # TODO [re_tests:928] reuse captured group not ok 929 # TODO [re_tests:929] reuse captured group not ok 930 # TODO [re_tests:930] reuse captured group not ok 931 # TODO [re_tests:931] reuse captured group not ok 932 # TODO [re_tests:932] reuse captured group not ok 933 # TODO [re_tests:933] reuse captured group not ok 934 # TODO [re_tests:934] reuse captured group not ok 935 # TODO [re_tests:935] reuse captured group not ok 936 # TODO [re_tests:936] reuse captured group not ok 937 # TODO [re_tests:937] reuse captured group not ok 938 # TODO [re_tests:938] reuse captured group not ok 939 # TODO [re_tests:939] reuse captured group not ok 940 # TODO [re_tests:940] reuse captured group not ok 941 # TODO [re_tests:941] reuse captured group not ok 942 # TODO [re_tests:942] reuse captured group ok 944 # SKIP [re_tests:944] unknown reason ok 945 # SKIP [re_tests:945] unknown reason ok 957 # SKIP [re_tests:957] ok 958 # SKIP [re_tests:958] not ok 959 # TODO [re_tests:959] [perl #34195] not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion ok t/compilers/pge/perl6regex/01-regex.... not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&|) - parse error not ok 99 # TODO [rx_metachars:114] null pattern invalid not ok 386 # TODO [rx_backtrack:4] basic not ok 427 # TODO [rx_charclass:26] illegal character range not ok 458 # TODO [rx_charclass:62] literal match (\") not ok 459 # TODO [rx_charclass:64] literal match (\") not ok 460 # TODO [rx_charclass:66] literal match with quote not ok 461 # TODO [rx_charclass:68] literal match with quote not ok 462 # TODO [rx_charclass:70] literal match with backslash not ok 463 # TODO [rx_charclass:72] literal match with interpolation not ok 464 # TODO [rx_charclass:74] literal match with interpolation not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i) not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s) not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s) not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s) not ok 709 # TODO [rx_modifiers:131] basic ws match not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5) not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth) not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth) ok t/compilers/pge/perl6regex/context..... not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented ok t/compilers/tge/basic..................ok t/compilers/tge/grammar................ not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug ok t/compilers/tge/parser.................ok t/library/cgi_query_hash...............ok t/library/coroutine....................ok t/library/dumper.......................ok t/library/getopt_obj...................ok t/library/hllmacros....................ok t/library/iter.........................ok t/library/md5..........................ok t/library/mime_base64..................ok t/library/mt19937ar....................ok t/library/p6object..................... not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) > ok t/library/parrotlib....................ok t/library/pcre......................... ok 1 # SKIP no pcre-config ok t/library/pg........................... ok 1 # SKIP skipped ok 2 # SKIP skipped ok 3 # SKIP skipped ok 4 # SKIP skipped ok 5 # SKIP skipped ok 6 # SKIP skipped ok 7 # SKIP skipped ok 8 # SKIP skipped ok 9 # SKIP skipped ok 10 # SKIP skipped ok 11 # SKIP skipped ok 12 # SKIP skipped ok 13 # SKIP skipped ok 14 # SKIP skipped ok 15 # SKIP skipped ok 16 # SKIP skipped ok 17 # SKIP skipped ok 18 # SKIP skipped ok 19 # SKIP skipped ok 20 # SKIP skipped ok 21 # SKIP skipped ok 22 # SKIP skipped ok 23 # SKIP skipped ok 24 # SKIP skipped ok 25 # SKIP skipped ok 26 # SKIP skipped ok 27 # SKIP skipped ok 28 # SKIP skipped ok 29 # SKIP skipped ok 30 # SKIP skipped ok 31 # SKIP skipped ok 32 # SKIP skipped ok 33 # SKIP skipped ok 34 # SKIP skipped ok 35 # SKIP skipped ok 36 # SKIP skipped ok 37 # SKIP skipped ok 38 # SKIP skipped ok 39 # SKIP skipped ok 40 # SKIP skipped ok 41 # SKIP skipped ok 42 # SKIP skipped ok 43 # SKIP skipped ok t/library/protoobject..................ok t/library/rand.........................ok t/library/range........................ok t/library/streams...................... ok 18 # SKIP broken method invocation ok 20 # SKIP broken method invocation ok t/library/string_utils.................ok t/library/tcl_glob.....................ok t/library/tcl_lib......................ok t/library/test_builder_tester..........ok t/library/test_class...................ok t/library/test_more....................ok t/library/uuid.........................ok t/library/yaml_dumper.................. not ok 7 - properties # TODO not yet implemented not ok 8 - indent string # TODO not supported not ok 9 - back-referencing properties # TODO not yet implemented not ok 10 - self-referential properties (1) # TODO not yet implemented not ok 11 - self-referential properties (2) # TODO not yet implemented not ok 26 - custom dumper # TODO not yet implemented ok t/library/yaml_parser_syck............. not ok 1 - basic parsing # TODO Not properly implemented yet ok Test Summary Report ------------------- t/op/trans (Wstat: 0 Tests: 22 Failed: 0) TODO passed: 13 t/compilers/pge/pge_examples (Wstat: 256 Tests: 2 Failed: 1) Failed test: 2 Non-zero exit status: 1 Files=252, Tests=8027, 469 wallclock secs ( 6.01 usr 4.01 sys + 187.71 cusr 103.45 csys = 301.18 CPU) Result: FAIL make[1]: *** [testj] Error 1 make: [fulltest] Error 2 (ignored)